BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1217X (491 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC27B12.06 |gpi13||pig-O |Schizosaccharomyces pombe|chr 2|||Ma... 26 2.7 SPBC947.01 |||AAA family ATPase, unknown biological role|Schizos... 25 8.2 SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyc... 25 8.2 >SPBC27B12.06 |gpi13||pig-O |Schizosaccharomyces pombe|chr 2|||Manual Length = 918 Score = 26.2 bits (55), Expect = 2.7 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 393 SVLYVRSCYLVRFVSTHCTTTSQHKHSIKKG 485 SVL+ + YL +F++ TTTSQ + G Sbjct: 117 SVLHPENSYLTQFIADAPTTTSQRLKGLTTG 147 >SPBC947.01 |||AAA family ATPase, unknown biological role|Schizosaccharomyces pombe|chr 2|||Manual Length = 660 Score = 24.6 bits (51), Expect = 8.2 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -1 Query: 323 NAIASLIAASGEGVEVERAAPAVDTGRS 240 N+ AS IAA+ + +A + DTGRS Sbjct: 190 NSSASAIAAASKSAAASASALSSDTGRS 217 >SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 24.6 bits (51), Expect = 8.2 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = -2 Query: 265 PPPWTQGEVSIVSGDGCPPP 206 PPPW S+ S P P Sbjct: 406 PPPWAAASTSVSSSTSSPAP 425 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,004,754 Number of Sequences: 5004 Number of extensions: 40337 Number of successful extensions: 66 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 192109570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -