BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1217X (491 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY070905-1|AAL48527.1| 1051|Drosophila melanogaster RE02096p pro... 28 7.9 AE014298-1761|AAN09307.1| 618|Drosophila melanogaster CG32651-P... 28 7.9 AE014296-3007|AAF49271.2| 1051|Drosophila melanogaster CG13699-P... 28 7.9 >AY070905-1|AAL48527.1| 1051|Drosophila melanogaster RE02096p protein. Length = 1051 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -2 Query: 304 SLRRVKE*RSSAPPPPWTQGEVSIVSGDGCPPPSYHQNYTN 182 S RR S PPPP T PPPSY T+ Sbjct: 218 SYRRPTRPPPSLPPPPTTAAHKISYDSHDYPPPSYAAEQTS 258 >AE014298-1761|AAN09307.1| 618|Drosophila melanogaster CG32651-PA protein. Length = 618 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -3 Query: 237 LLCRVTVVRPQVTTKTIQIYRFCICLKEPFSMSK 136 +LCR V P T+Q +R C+CL+E + K Sbjct: 4 VLCRKPTVTP---FSTLQKFRVCVCLQEHYQCLK 34 >AE014296-3007|AAF49271.2| 1051|Drosophila melanogaster CG13699-PA protein. Length = 1051 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -2 Query: 304 SLRRVKE*RSSAPPPPWTQGEVSIVSGDGCPPPSYHQNYTN 182 S RR S PPPP T PPPSY T+ Sbjct: 218 SYRRPTRPPPSLPPPPTTAAHKISYDSHDYPPPSYAAEQTS 258 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,741,154 Number of Sequences: 53049 Number of extensions: 505504 Number of successful extensions: 1236 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1236 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1721789184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -