BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1217X (491 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 5.4 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 21 7.1 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 21 9.4 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 21 9.4 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 21 9.4 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 5.4 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 378 YPSFCSFG 355 YP+FC+FG Sbjct: 616 YPNFCAFG 623 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 21.0 bits (42), Expect = 7.1 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -2 Query: 130 GGLYFIQCKTVNILLGDF 77 G YF+ N+LL DF Sbjct: 101 GNFYFVHESLKNVLLWDF 118 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 20.6 bits (41), Expect = 9.4 Identities = 12/37 (32%), Positives = 14/37 (37%) Frame = -2 Query: 292 VKE*RSSAPPPPWTQGEVSIVSGDGCPPPSYHQNYTN 182 V + R PP T G IV+ C P TN Sbjct: 405 VTQKREGGPPTGATTGPNEIVTCTNCGPNPCTHTTTN 441 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 20.6 bits (41), Expect = 9.4 Identities = 12/37 (32%), Positives = 14/37 (37%) Frame = -2 Query: 292 VKE*RSSAPPPPWTQGEVSIVSGDGCPPPSYHQNYTN 182 V + R PP T G IV+ C P TN Sbjct: 425 VTQKREGGPPTGATTGPNEIVTCTNCGPNPCTHTTTN 461 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 20.6 bits (41), Expect = 9.4 Identities = 12/37 (32%), Positives = 14/37 (37%) Frame = -2 Query: 292 VKE*RSSAPPPPWTQGEVSIVSGDGCPPPSYHQNYTN 182 V + R PP T G IV+ C P TN Sbjct: 374 VTQKREGGPPTGATTGPNEIVTCTNCGPNPCTHTTTN 410 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,280 Number of Sequences: 438 Number of extensions: 2969 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13544190 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -