BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1216 (641 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory recept... 23 2.8 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 21 8.6 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 8.6 >AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory receptor candidate 22 protein. Length = 301 Score = 22.6 bits (46), Expect = 2.8 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +1 Query: 361 ILMNIILRI*FALPRPLIVYWVIYCDYTIIFLFNFY 468 IL+ +++ + F + WV D +IFL N+Y Sbjct: 58 ILLMVLVNLIFNTCGEVFSAWVRCQDQILIFLVNWY 93 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -3 Query: 54 SHFFSQCNRVILKKKKK 4 S FF C I+KK++K Sbjct: 362 SGFFKLCGMKIVKKRRK 378 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/36 (22%), Positives = 18/36 (50%) Frame = +2 Query: 377 YYEFSLLYHDHLLFIGLSTVITQSYFCSIFIFMFTI 484 +Y +++ HLLF + ++ Y+ +FT+ Sbjct: 215 FYSAFIIFTIHLLFYCVLIILLCIYYFYYAFILFTV 250 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,777 Number of Sequences: 336 Number of extensions: 2624 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -