BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1216 (641 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14171| Best HMM Match : Chitin_synth_2 (HMM E-Value=7.7e-07) 28 5.6 >SB_14171| Best HMM Match : Chitin_synth_2 (HMM E-Value=7.7e-07) Length = 1188 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +1 Query: 370 NIILRI*FALPRPLIVYWVIYCDYTIIFLFNFYFHVYHIGLTDKL 504 N ++ I F L + L V + C T+I + + H H+G+ D+L Sbjct: 657 NDMVSIWFILYQALNVVATLICPATVILIISGALHYAHLGVEDEL 701 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,301,569 Number of Sequences: 59808 Number of extensions: 255735 Number of successful extensions: 349 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 301 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 349 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -