BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1215 (584 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7BQ70 Cluster: Putative peptide synthetase/polyketide ... 33 6.6 UniRef50_O74718 Cluster: Eukaryotic peptide chain release factor... 32 8.7 >UniRef50_Q7BQ70 Cluster: Putative peptide synthetase/polyketide synthase; n=1; Bacillus cereus|Rep: Putative peptide synthetase/polyketide synthase - Bacillus cereus Length = 2562 Score = 32.7 bits (71), Expect = 6.6 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = -3 Query: 165 NRTQEQ*ILDEIDLH-KVLRGLNRLNQQKEPTMKTGLR-TPALISATKSPMYKEIK 4 NR Q+Q ++ IDLH K+L G N N+ E K L+ + +S T P EI+ Sbjct: 2409 NRNQQQVVVSPIDLHWKLLNGANYYNELLEKGSKNRLKQNRSDVSTTYRPPTNEIE 2464 >UniRef50_O74718 Cluster: Eukaryotic peptide chain release factor GTP-binding subunit; n=2; Schizosaccharomyces pombe|Rep: Eukaryotic peptide chain release factor GTP-binding subunit - Schizosaccharomyces pombe (Fission yeast) Length = 662 Score = 32.3 bits (70), Expect = 8.7 Identities = 23/97 (23%), Positives = 51/97 (52%), Gaps = 3/97 (3%) Frame = -3 Query: 510 ETGLRTPALISATKSPMYKQSKFI*TFAISETV*KLXCNYKQMEPKNNKTQSEIDLHKVL 331 ++ ++T ++++TK+P++ ++FI AI E L Y + + + E+ K+L Sbjct: 538 DSDVQTGYVLTSTKNPVHATTRFIAQIAILELPSILTTGYSCVMHIHTAVE-EVSFAKLL 596 Query: 330 RGLNRVNQQ-KEPTM--KTGLRTPALISELSPRCTSK 229 L++ N++ K+P M G++ A + +P C + Sbjct: 597 HKLDKTNRKSKKPPMFATKGMKIIAELETQTPVCMER 633 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 492,694,233 Number of Sequences: 1657284 Number of extensions: 8343033 Number of successful extensions: 18876 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18873 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 40820699206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -