BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1215 (584 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 5.5 AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor O... 23 7.3 AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembran... 23 7.3 AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembran... 23 7.3 AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 23 7.3 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 23 7.3 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.4 bits (48), Expect = 5.5 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +3 Query: 144 FIVLGFYSFVITL*F*AVSEIA 209 F+ +GFYS +++L +SE A Sbjct: 2997 FLTVGFYSLIVSLRMSLISESA 3018 >AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor Or83b protein. Length = 478 Score = 23.0 bits (47), Expect = 7.3 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = +2 Query: 143 IYCSWVLFVCNYIIILSSFRDSKCLNKPALLVHRGLSSEI 262 ++CSW+L C + L S +L +R SS++ Sbjct: 217 MFCSWLLLACEQLQHLKGIMRSLMELSASLDTYRPNSSQL 256 >AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 331 Score = 23.0 bits (47), Expect = 7.3 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = +2 Query: 143 IYCSWVLFVCNYIIILSSFRDSKCLNKPALLVHRGLSSEI 262 ++CSW+L C + L S +L +R SS++ Sbjct: 70 MFCSWLLLACEQLQHLKGIMRSLMELSASLDTYRPNSSQL 109 >AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 478 Score = 23.0 bits (47), Expect = 7.3 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = +2 Query: 143 IYCSWVLFVCNYIIILSSFRDSKCLNKPALLVHRGLSSEI 262 ++CSW+L C + L S +L +R SS++ Sbjct: 217 MFCSWLLLACEQLQHLKGIMRSLMELSASLDTYRPNSSQL 256 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 23.0 bits (47), Expect = 7.3 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 295 RFFLLIDTIESAKYFMKINLTLCFVILGFHLFVI 396 R + L TI KY ++LTLC F F++ Sbjct: 37 REYCLNTTIHGLKYIGTVSLTLCERAYFFLTFLV 70 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 23.0 bits (47), Expect = 7.3 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 295 RFFLLIDTIESAKYFMKINLTLCFVILGFHLFVI 396 R + L TI KY ++LTLC F F++ Sbjct: 37 REYCLNTTIHGLKYIGTVSLTLCERAYFFLTFLV 70 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 526,904 Number of Sequences: 2352 Number of extensions: 8818 Number of successful extensions: 14 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55927431 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -