BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1214 (700 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 25 0.79 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 23 1.8 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 23 3.2 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 22 5.5 AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 22 5.5 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 22 5.5 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 5.5 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 21 7.3 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 7.3 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 7.3 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 7.3 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 7.3 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 24.6 bits (51), Expect = 0.79 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -1 Query: 268 TALSNGAATPTGDTDGLLSPGCHGG 194 +A +TPT T GLLSP +GG Sbjct: 179 SATPQAGSTPTYQTQGLLSPS-YGG 202 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 23.4 bits (48), Expect = 1.8 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -2 Query: 159 YPHGGDGYNVVRTPAFLYSREIRRTVRALPTW 64 YP G+ ++++RTP L+ E R ++ P + Sbjct: 39 YPIIGNLFDIMRTPEQLFLAERERGLKYYPIY 70 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 22.6 bits (46), Expect = 3.2 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = -2 Query: 408 LRYLKAPLVDREDPK*RIWGDVDCFTLCPQDRECSYRRP 292 LRY K P + P +G L P D C+ RP Sbjct: 427 LRYAKGPYQPSQAPPTYDYGIPQGVVLNPLDARCNEIRP 465 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.8 bits (44), Expect = 5.5 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -1 Query: 109 VFTRNTQDGSRSPDVEFNFSLGRAVQDHV 23 ++TRN D S+ EF SL +DH+ Sbjct: 285 IWTRNADDISQEEYGEFYKSLTNDWEDHL 313 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 407 KHRSSFSSNPSLARRAR 457 KH++ S NP RR R Sbjct: 76 KHKADISGNPRALRRLR 92 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 407 KHRSSFSSNPSLARRAR 457 KH++ S NP RR R Sbjct: 76 KHKADISGNPRALRRLR 92 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +3 Query: 222 PSVSPVGVAAP 254 P++SPVGVA P Sbjct: 116 PTLSPVGVALP 126 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/32 (25%), Positives = 19/32 (59%) Frame = -2 Query: 159 YPHGGDGYNVVRTPAFLYSREIRRTVRALPTW 64 YP G+ ++++RTP ++ + R ++ P + Sbjct: 39 YPIIGNLFDIMRTPEQMFLADRERGLKYYPIY 70 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 177 SRSSDGYPHGGDGYN 133 S +SD Y H +G+N Sbjct: 857 SAASDAYTHAPEGFN 871 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 177 SRSSDGYPHGGDGYN 133 S +SD Y H +G+N Sbjct: 857 SAASDAYTHAPEGFN 871 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 177 SRSSDGYPHGGDGYN 133 S +SD Y H +G+N Sbjct: 857 SAASDAYTHAPEGFN 871 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 177 SRSSDGYPHGGDGYN 133 S +SD Y H +G+N Sbjct: 857 SAASDAYTHAPEGFN 871 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,925 Number of Sequences: 336 Number of extensions: 2956 Number of successful extensions: 13 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -