BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1214 (700 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82079-1|CAB04949.1| 1529|Caenorhabditis elegans Hypothetical pr... 29 4.2 Z80344-7|CAB02491.1| 1529|Caenorhabditis elegans Hypothetical pr... 29 4.2 Z81086-4|CAB03117.1| 342|Caenorhabditis elegans Hypothetical pr... 28 7.4 >Z82079-1|CAB04949.1| 1529|Caenorhabditis elegans Hypothetical protein F15D4.1 protein. Length = 1529 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 4/41 (9%) Frame = +1 Query: 271 DTRTLSSWPPVTT---FPILRTQCKAVDVAPNTSF-RILPI 381 DTR L+ W + FP+L QC+ V A +F R++P+ Sbjct: 888 DTRYLNGWATLLAPVIFPLLADQCETVRDAAGEAFRRLIPV 928 >Z80344-7|CAB02491.1| 1529|Caenorhabditis elegans Hypothetical protein F15D4.1 protein. Length = 1529 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 4/41 (9%) Frame = +1 Query: 271 DTRTLSSWPPVTT---FPILRTQCKAVDVAPNTSF-RILPI 381 DTR L+ W + FP+L QC+ V A +F R++P+ Sbjct: 888 DTRYLNGWATLLAPVIFPLLADQCETVRDAAGEAFRRLIPV 928 >Z81086-4|CAB03117.1| 342|Caenorhabditis elegans Hypothetical protein F53B6.4 protein. Length = 342 Score = 27.9 bits (59), Expect = 7.4 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = -3 Query: 164 TAIPMVATATTLCARPLFCIHAKYAGRFALSRRGIQFFTRKGSSRSRK 21 T++PMVA A CA+ +HAK + S+ + +G+S+S K Sbjct: 53 TSLPMVA-AIAFCAKNRKTVHAKNKNKNKSSKSAKSSKSTRGASKSGK 99 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,770,470 Number of Sequences: 27780 Number of extensions: 305376 Number of successful extensions: 797 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 797 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -