BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1213 (730 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0710 + 10587969-10588069,10588181-10588262,10588362-105884... 29 5.0 >03_02_0710 + 10587969-10588069,10588181-10588262,10588362-10588414, 10588828-10589315,10589415-10589575,10589699-10589896, 10590091-10590277,10590355-10590611 Length = 508 Score = 28.7 bits (61), Expect = 5.0 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +3 Query: 453 CILNGTLYTYCT-HGLLQSFVTLCIYECMMQTVYNH 557 C+L+ LY+YC+ HG++ F CI+E + V +H Sbjct: 316 CVLDDKLYSYCSGHGIILLF--NCIHEVVGVIVGSH 349 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,454,312 Number of Sequences: 37544 Number of extensions: 328768 Number of successful extensions: 576 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 566 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 576 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1909952136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -