BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1213 (730 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 24 1.3 DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. 21 9.0 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 21 9.0 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 24.2 bits (50), Expect = 1.3 Identities = 13/31 (41%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = -2 Query: 603 ETSMNCSV*TVYVLSDDYRQ--FASYIRKYR 517 + S++ S T+YVLSD+++Q F+ Y K R Sbjct: 350 DLSIDRSTNTMYVLSDNFQQLLFSKYDAKKR 380 >DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. Length = 135 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 702 DENFKLYIMCA 670 DEN +LYI CA Sbjct: 56 DENVQLYIECA 66 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -2 Query: 489 ECSMYIKFHLKYKLLV 442 EC IK L+YKLL+ Sbjct: 471 ECGYEIKKLLRYKLLI 486 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 203,675 Number of Sequences: 438 Number of extensions: 4329 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -