BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1208 (725 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 3.3 AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 22 5.8 AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory recept... 22 5.8 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.6 bits (46), Expect = 3.3 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 Query: 539 CFKYFSYIFIVFLDGLLISI*YY 607 C YF Y FI+F LL + Y Sbjct: 112 CVYYFYYAFIIFTVHLLFLLCIY 134 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/39 (28%), Positives = 23/39 (58%) Frame = -3 Query: 528 IFT*IKLIYSINKYI*VPTTQKTQSTTIHKY*KNYSYFN 412 I+T +K +Y+I K I + T + + + ++ +Y YF+ Sbjct: 21 IYTSMKPVYAICKLIGLNTLRIGRKGELKQHKSDYFYFS 59 >AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory receptor candidate 11 protein. Length = 344 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/39 (28%), Positives = 23/39 (58%) Frame = -3 Query: 528 IFT*IKLIYSINKYI*VPTTQKTQSTTIHKY*KNYSYFN 412 I+T +K +Y+I K I + T + + + ++ +Y YF+ Sbjct: 21 IYTSMKPVYAICKLIGLNTLRIGRKGELKQHKSDYFYFS 59 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,184 Number of Sequences: 336 Number of extensions: 1853 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19363530 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -