BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1204X (455 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 23 1.8 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 22 3.1 DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 prot... 21 4.1 AY873915-1|AAW67571.2| 384|Tribolium castaneum chitinase 16 pro... 21 4.1 AY873914-1|AAW67570.1| 384|Tribolium castaneum chitinase 3 prot... 21 4.1 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 22.6 bits (46), Expect = 1.8 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -2 Query: 427 SIAYVLLQSLFSASAVFVVILL 362 +I Y L SLF ++A+ V+ILL Sbjct: 368 NIDYGTLYSLFGSTAMNVIILL 389 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.8 bits (44), Expect = 3.1 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 6/49 (12%) Frame = -1 Query: 410 IAVVVLSLRRFRRYLTAGRIIN------LLILVIRCEGYLGMFASALLT 282 I V SL +T G++ N LLILV+ G G F + +L+ Sbjct: 335 ILVYYASLDETPNPVTNGKLYNFNTFAKLLILVVSLSGTFGFFGTHILS 383 >DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 protein. Length = 383 Score = 21.4 bits (43), Expect = 4.1 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -1 Query: 161 KRQMKHVVSGXQW 123 ++Q+ H+V G QW Sbjct: 317 EQQVPHIVKGNQW 329 >AY873915-1|AAW67571.2| 384|Tribolium castaneum chitinase 16 protein. Length = 384 Score = 21.4 bits (43), Expect = 4.1 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -1 Query: 161 KRQMKHVVSGXQW 123 ++Q+ H+V G QW Sbjct: 318 EQQVPHIVKGNQW 330 >AY873914-1|AAW67570.1| 384|Tribolium castaneum chitinase 3 protein. Length = 384 Score = 21.4 bits (43), Expect = 4.1 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -1 Query: 161 KRQMKHVVSGXQW 123 ++Q+ H+V G QW Sbjct: 318 EQQVPHIVKGNQW 330 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,371 Number of Sequences: 336 Number of extensions: 2337 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10406187 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -