BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1204X (455 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC050029-1|AAH50029.1| 639|Homo sapiens PARN protein protein. 88 1e-17 AJ005698-1|CAA06683.1| 639|Homo sapiens poly(A)-specific ribonu... 88 1e-17 AB053446-1|BAB61903.2| 3434|Homo sapiens KIAA1773 protein protein. 30 4.3 Y14768-13|CAA75072.1| 381|Homo sapiens I Kappa B-like protein p... 29 5.7 X77909-1|CAA54867.1| 381|Homo sapiens IKBL protein. 29 5.7 BX248516-20|CAI41933.2| 358|Homo sapiens nuclear factor of kapp... 29 5.7 BX248516-19|CAI41931.2| 366|Homo sapiens nuclear factor of kapp... 29 5.7 BX248516-18|CAI41932.1| 381|Homo sapiens nuclear factor of kapp... 29 5.7 BX001040-16|CAI18644.1| 156|Homo sapiens nuclear factor of kapp... 29 5.7 BX001040-15|CAI18643.1| 366|Homo sapiens nuclear factor of kapp... 29 5.7 BX001040-14|CAI18642.1| 381|Homo sapiens nuclear factor of kapp... 29 5.7 BX001040-13|CAI18641.1| 125|Homo sapiens nuclear factor of kapp... 29 5.7 BC105068-1|AAI05069.1| 381|Homo sapiens nuclear factor of kappa... 29 5.7 BC105064-1|AAI05065.1| 381|Homo sapiens nuclear factor of kappa... 29 5.7 BA000025-38|BAB63398.1| 381|Homo sapiens NFKBIL1 protein. 29 5.7 AL929587-25|CAI18667.2| 358|Homo sapiens nuclear factor of kapp... 29 5.7 AL929587-24|CAI18668.1| 381|Homo sapiens nuclear factor of kapp... 29 5.7 AL929587-23|CAI18666.2| 366|Homo sapiens nuclear factor of kapp... 29 5.7 AL662847-37|CAI17674.2| 358|Homo sapiens nuclear factor of kapp... 29 5.7 AL662847-36|CAI17676.1| 366|Homo sapiens nuclear factor of kapp... 29 5.7 AL662847-35|CAI17675.1| 381|Homo sapiens nuclear factor of kapp... 29 5.7 AL662801-20|CAI18288.2| 358|Homo sapiens nuclear factor of kapp... 29 5.7 AL662801-19|CAI18290.1| 366|Homo sapiens nuclear factor of kapp... 29 5.7 AL662801-18|CAI18289.1| 381|Homo sapiens nuclear factor of kapp... 29 5.7 AF097429-1|AAD38118.1| 381|Homo sapiens IkBL protein protein. 29 5.7 AF097428-1|AAD38117.1| 381|Homo sapiens IkBL protein protein. 29 5.7 AF097427-1|AAD38116.1| 381|Homo sapiens IkBL protein protein. 29 5.7 AF097426-1|AAD38115.1| 381|Homo sapiens IkBL protein protein. 29 5.7 AF097425-1|AAD38114.1| 381|Homo sapiens IkBL protein protein. 29 5.7 AF097424-1|AAD38113.1| 381|Homo sapiens IkBL protein protein. 29 5.7 AF097423-1|AAD38112.1| 381|Homo sapiens IkBL protein protein. 29 5.7 AF097422-1|AAD38111.1| 381|Homo sapiens IkBL protein protein. 29 5.7 AF097421-1|AAD38110.1| 381|Homo sapiens IkBL protein protein. 29 5.7 AF097420-1|AAD38109.1| 381|Homo sapiens IkBL protein protein. 29 5.7 AF097419-1|AAD38108.1| 381|Homo sapiens IkBL protein protein. 29 5.7 AB202112-1|BAE78635.1| 381|Homo sapiens nuclear factor of kappa... 29 5.7 AB103621-1|BAF31285.1| 381|Homo sapiens IKBL protein protein. 29 5.7 AB088115-1|BAC54951.1| 381|Homo sapiens nuclear factor of kappa... 29 5.7 Z92910-1|CAB07442.1| 348|Homo sapiens HFE protein. 29 10.0 Y09801-1|CAA70934.1| 348|Homo sapiens HFE protein. 29 10.0 U91328-2|AAB82083.1| 348|Homo sapiens hereditary hemochromatosi... 29 10.0 U60319-1|AAC51823.1| 348|Homo sapiens haemochromatosis protein ... 29 10.0 BC117203-1|AAI17204.1| 348|Homo sapiens hemochromatosis protein. 29 10.0 BC117201-1|AAI17202.1| 348|Homo sapiens hemochromatosis protein. 29 10.0 BC074721-1|AAH74721.1| 345|Homo sapiens HFE protein protein. 29 10.0 AY205604-1|AAO47091.1| 268|Homo sapiens hemochromatosis protein. 29 10.0 AJ250635-1|CAC80805.1| 168|Homo sapiens Hemochromatosis protein... 29 10.0 AJ249337-1|CAC67794.1| 256|Homo sapiens hemochromatosis protein... 29 10.0 AJ249336-1|CAC67793.1| 260|Homo sapiens hemochromatosis protein... 29 10.0 AJ249335-1|CAC67792.1| 325|Homo sapiens hemochromatosis protein... 29 10.0 AF525499-1|AAM91950.1| 129|Homo sapiens hereditary hemochromato... 29 10.0 AF184234-1|AAF01222.1| 129|Homo sapiens hereditary haemochromat... 29 10.0 AF144242-1|AAG29577.1| 256|Homo sapiens hemochromatosis splice ... 29 10.0 AF115265-1|AAG29572.1| 348|Homo sapiens hemochromatosis termina... 29 10.0 AF079409-1|AAC62648.1| 246|Homo sapiens hemochromatosis splice ... 29 10.0 AF079408-1|AAC62647.1| 260|Homo sapiens hemochromatosis splice ... 29 10.0 AF079407-1|AAC62646.1| 334|Homo sapiens hemochromatosis splice ... 29 10.0 >BC050029-1|AAH50029.1| 639|Homo sapiens PARN protein protein. Length = 639 Score = 88.2 bits (209), Expect = 1e-17 Identities = 41/78 (52%), Positives = 54/78 (69%) Frame = +3 Query: 21 LSITSPLIKPFLNKVFLSRTAHQDSPFINLAGPEPLXPRDHVFHLAFPREW*RNEITQLF 200 +S S LI+PF NK+FL R D P++NL GP+ RDHV H+ FP+EW +++ QLF Sbjct: 408 VSARSKLIEPFFNKLFLMRV--MDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLF 465 Query: 201 SPFGPITVQFIDDTSAFV 254 S FG I + +IDDTSAFV Sbjct: 466 SAFGNIQISWIDDTSAFV 483 >AJ005698-1|CAA06683.1| 639|Homo sapiens poly(A)-specific ribonuclease protein. Length = 639 Score = 88.2 bits (209), Expect = 1e-17 Identities = 41/78 (52%), Positives = 54/78 (69%) Frame = +3 Query: 21 LSITSPLIKPFLNKVFLSRTAHQDSPFINLAGPEPLXPRDHVFHLAFPREW*RNEITQLF 200 +S S LI+PF NK+FL R D P++NL GP+ RDHV H+ FP+EW +++ QLF Sbjct: 408 VSARSKLIEPFFNKLFLMRV--MDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLF 465 Query: 201 SPFGPITVQFIDDTSAFV 254 S FG I + +IDDTSAFV Sbjct: 466 SAFGNIQISWIDDTSAFV 483 >AB053446-1|BAB61903.2| 3434|Homo sapiens KIAA1773 protein protein. Length = 3434 Score = 29.9 bits (64), Expect = 4.3 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +3 Query: 288 QSTREHSKITLTSYYKYKKINDTPSSKITTKTAEAENNDCNKTYAILHY-IISGNF 452 Q +H+ S+Y+ D P T T EA + D ++++A + Y IISGN+ Sbjct: 2609 QDQNDHAPSFTLSHYRVAVTEDLPPGS-TLLTLEATDADGSRSHAAVDYSIISGNW 2663 >Y14768-13|CAA75072.1| 381|Homo sapiens I Kappa B-like protein protein. Length = 381 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >X77909-1|CAA54867.1| 381|Homo sapiens IKBL protein. Length = 381 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >BX248516-20|CAI41933.2| 358|Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-li protein. Length = 358 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 12 RRFRRYLSAGRLVRAQALLQRHPG 35 >BX248516-19|CAI41931.2| 366|Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-li protein. Length = 366 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >BX248516-18|CAI41932.1| 381|Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-li protein. Length = 381 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >BX001040-16|CAI18644.1| 156|Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-li protein. Length = 156 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 12 RRFRRYLSAGRLVRAQALLQRHPG 35 >BX001040-15|CAI18643.1| 366|Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-li protein. Length = 366 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >BX001040-14|CAI18642.1| 381|Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-li protein. Length = 381 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >BX001040-13|CAI18641.1| 125|Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-li protein. Length = 125 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >BC105068-1|AAI05069.1| 381|Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-li protein. Length = 381 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >BC105064-1|AAI05065.1| 381|Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-li protein. Length = 381 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >BA000025-38|BAB63398.1| 381|Homo sapiens NFKBIL1 protein. Length = 381 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >AL929587-25|CAI18667.2| 358|Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-li protein. Length = 358 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 12 RRFRRYLSAGRLVRAQALLQRHPG 35 >AL929587-24|CAI18668.1| 381|Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-li protein. Length = 381 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >AL929587-23|CAI18666.2| 366|Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-li protein. Length = 366 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >AL662847-37|CAI17674.2| 358|Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-li protein. Length = 358 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 12 RRFRRYLSAGRLVRAQALLQRHPG 35 >AL662847-36|CAI17676.1| 366|Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-li protein. Length = 366 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >AL662847-35|CAI17675.1| 381|Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-li protein. Length = 381 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >AL662801-20|CAI18288.2| 358|Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-li protein. Length = 358 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 12 RRFRRYLSAGRLVRAQALLQRHPG 35 >AL662801-19|CAI18290.1| 366|Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-li protein. Length = 366 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >AL662801-18|CAI18289.1| 381|Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-li protein. Length = 381 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >AF097429-1|AAD38118.1| 381|Homo sapiens IkBL protein protein. Length = 381 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >AF097428-1|AAD38117.1| 381|Homo sapiens IkBL protein protein. Length = 381 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >AF097427-1|AAD38116.1| 381|Homo sapiens IkBL protein protein. Length = 381 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >AF097426-1|AAD38115.1| 381|Homo sapiens IkBL protein protein. Length = 381 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >AF097425-1|AAD38114.1| 381|Homo sapiens IkBL protein protein. Length = 381 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >AF097424-1|AAD38113.1| 381|Homo sapiens IkBL protein protein. Length = 381 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >AF097423-1|AAD38112.1| 381|Homo sapiens IkBL protein protein. Length = 381 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >AF097422-1|AAD38111.1| 381|Homo sapiens IkBL protein protein. Length = 381 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >AF097421-1|AAD38110.1| 381|Homo sapiens IkBL protein protein. Length = 381 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >AF097420-1|AAD38109.1| 381|Homo sapiens IkBL protein protein. Length = 381 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >AF097419-1|AAD38108.1| 381|Homo sapiens IkBL protein protein. Length = 381 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >AB202112-1|BAE78635.1| 381|Homo sapiens nuclear factor of kappa light polypeptide gene enhancer protein. Length = 381 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >AB103621-1|BAF31285.1| 381|Homo sapiens IKBL protein protein. Length = 381 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >AB088115-1|BAC54951.1| 381|Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-li protein. Length = 381 Score = 29.5 bits (63), Expect = 5.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 386 RRFRRYLTAGRIINLLILVIRCEG 315 RRFRRYL+AGR++ L+ R G Sbjct: 35 RRFRRYLSAGRLVRAQALLQRHPG 58 >Z92910-1|CAB07442.1| 348|Homo sapiens HFE protein. Length = 348 Score = 28.7 bits (61), Expect = 10.0 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -2 Query: 454 LKLPLMI*W--SIAYVLLQSLFSASAVFVVILLLGVSLIFL 338 L PL++ W S + L+ + S AVFVVIL +G+ I L Sbjct: 289 LDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIIL 329 >Y09801-1|CAA70934.1| 348|Homo sapiens HFE protein. Length = 348 Score = 28.7 bits (61), Expect = 10.0 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -2 Query: 454 LKLPLMI*W--SIAYVLLQSLFSASAVFVVILLLGVSLIFL 338 L PL++ W S + L+ + S AVFVVIL +G+ I L Sbjct: 289 LDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIIL 329 >U91328-2|AAB82083.1| 348|Homo sapiens hereditary hemochromatosis protein. Length = 348 Score = 28.7 bits (61), Expect = 10.0 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -2 Query: 454 LKLPLMI*W--SIAYVLLQSLFSASAVFVVILLLGVSLIFL 338 L PL++ W S + L+ + S AVFVVIL +G+ I L Sbjct: 289 LDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIIL 329 >U60319-1|AAC51823.1| 348|Homo sapiens haemochromatosis protein protein. Length = 348 Score = 28.7 bits (61), Expect = 10.0 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -2 Query: 454 LKLPLMI*W--SIAYVLLQSLFSASAVFVVILLLGVSLIFL 338 L PL++ W S + L+ + S AVFVVIL +G+ I L Sbjct: 289 LDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIIL 329 >BC117203-1|AAI17204.1| 348|Homo sapiens hemochromatosis protein. Length = 348 Score = 28.7 bits (61), Expect = 10.0 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -2 Query: 454 LKLPLMI*W--SIAYVLLQSLFSASAVFVVILLLGVSLIFL 338 L PL++ W S + L+ + S AVFVVIL +G+ I L Sbjct: 289 LDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIIL 329 >BC117201-1|AAI17202.1| 348|Homo sapiens hemochromatosis protein. Length = 348 Score = 28.7 bits (61), Expect = 10.0 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -2 Query: 454 LKLPLMI*W--SIAYVLLQSLFSASAVFVVILLLGVSLIFL 338 L PL++ W S + L+ + S AVFVVIL +G+ I L Sbjct: 289 LDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIIL 329 >BC074721-1|AAH74721.1| 345|Homo sapiens HFE protein protein. Length = 345 Score = 28.7 bits (61), Expect = 10.0 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -2 Query: 454 LKLPLMI*W--SIAYVLLQSLFSASAVFVVILLLGVSLIFL 338 L PL++ W S + L+ + S AVFVVIL +G+ I L Sbjct: 286 LDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIIL 326 >AY205604-1|AAO47091.1| 268|Homo sapiens hemochromatosis protein. Length = 268 Score = 28.7 bits (61), Expect = 10.0 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -2 Query: 454 LKLPLMI*W--SIAYVLLQSLFSASAVFVVILLLGVSLIFL 338 L PL++ W S + L+ + S AVFVVIL +G+ I L Sbjct: 209 LDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIIL 249 >AJ250635-1|CAC80805.1| 168|Homo sapiens Hemochromatosis protein protein. Length = 168 Score = 28.7 bits (61), Expect = 10.0 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -2 Query: 454 LKLPLMI*W--SIAYVLLQSLFSASAVFVVILLLGVSLIFL 338 L PL++ W S + L+ + S AVFVVIL +G+ I L Sbjct: 109 LDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIIL 149 >AJ249337-1|CAC67794.1| 256|Homo sapiens hemochromatosis protein protein. Length = 256 Score = 28.7 bits (61), Expect = 10.0 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -2 Query: 454 LKLPLMI*W--SIAYVLLQSLFSASAVFVVILLLGVSLIFL 338 L PL++ W S + L+ + S AVFVVIL +G+ I L Sbjct: 197 LDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIIL 237 >AJ249336-1|CAC67793.1| 260|Homo sapiens hemochromatosis protein protein. Length = 260 Score = 28.7 bits (61), Expect = 10.0 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -2 Query: 454 LKLPLMI*W--SIAYVLLQSLFSASAVFVVILLLGVSLIFL 338 L PL++ W S + L+ + S AVFVVIL +G+ I L Sbjct: 201 LDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIIL 241 >AJ249335-1|CAC67792.1| 325|Homo sapiens hemochromatosis protein protein. Length = 325 Score = 28.7 bits (61), Expect = 10.0 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -2 Query: 454 LKLPLMI*W--SIAYVLLQSLFSASAVFVVILLLGVSLIFL 338 L PL++ W S + L+ + S AVFVVIL +G+ I L Sbjct: 266 LDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIIL 306 >AF525499-1|AAM91950.1| 129|Homo sapiens hereditary hemochromatosis protein precursor protein. Length = 129 Score = 28.7 bits (61), Expect = 10.0 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -2 Query: 454 LKLPLMI*W--SIAYVLLQSLFSASAVFVVILLLGVSLIFL 338 L PL++ W S + L+ + S AVFVVIL +G+ I L Sbjct: 83 LDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIIL 123 >AF184234-1|AAF01222.1| 129|Homo sapiens hereditary haemochromatosis protein precursor protein. Length = 129 Score = 28.7 bits (61), Expect = 10.0 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -2 Query: 454 LKLPLMI*W--SIAYVLLQSLFSASAVFVVILLLGVSLIFL 338 L PL++ W S + L+ + S AVFVVIL +G+ I L Sbjct: 83 LDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIIL 123 >AF144242-1|AAG29577.1| 256|Homo sapiens hemochromatosis splice variant delE3 protein. Length = 256 Score = 28.7 bits (61), Expect = 10.0 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -2 Query: 454 LKLPLMI*W--SIAYVLLQSLFSASAVFVVILLLGVSLIFL 338 L PL++ W S + L+ + S AVFVVIL +G+ I L Sbjct: 197 LDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIIL 237 >AF115265-1|AAG29572.1| 348|Homo sapiens hemochromatosis termination variant terE6 protein. Length = 348 Score = 28.7 bits (61), Expect = 10.0 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -2 Query: 454 LKLPLMI*W--SIAYVLLQSLFSASAVFVVILLLGVSLIFL 338 L PL++ W S + L+ + S AVFVVIL +G+ I L Sbjct: 289 LDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIIL 329 >AF079409-1|AAC62648.1| 246|Homo sapiens hemochromatosis splice variant delE214E4 protein. Length = 246 Score = 28.7 bits (61), Expect = 10.0 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -2 Query: 454 LKLPLMI*W--SIAYVLLQSLFSASAVFVVILLLGVSLIFL 338 L PL++ W S + L+ + S AVFVVIL +G+ I L Sbjct: 187 LDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIIL 227 >AF079408-1|AAC62647.1| 260|Homo sapiens hemochromatosis splice variant delE2 protein. Length = 260 Score = 28.7 bits (61), Expect = 10.0 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -2 Query: 454 LKLPLMI*W--SIAYVLLQSLFSASAVFVVILLLGVSLIFL 338 L PL++ W S + L+ + S AVFVVIL +G+ I L Sbjct: 201 LDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIIL 241 >AF079407-1|AAC62646.1| 334|Homo sapiens hemochromatosis splice variant del14E4 protein. Length = 334 Score = 28.7 bits (61), Expect = 10.0 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -2 Query: 454 LKLPLMI*W--SIAYVLLQSLFSASAVFVVILLLGVSLIFL 338 L PL++ W S + L+ + S AVFVVIL +G+ I L Sbjct: 275 LDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIIL 315 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 68,142,952 Number of Sequences: 237096 Number of extensions: 1463874 Number of successful extensions: 3140 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 2991 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3138 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 3815180866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -