BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1204X (455 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U80441-8|AAB37656.1| 284|Caenorhabditis elegans Dumpy : shorter... 29 1.6 U80028-9|AAN73867.1| 372|Caenorhabditis elegans Serpentine rece... 29 2.1 AF022967-1|AAY86215.1| 370|Caenorhabditis elegans Hypothetical ... 27 4.9 Z93385-10|CAB07643.1| 702|Caenorhabditis elegans Hypothetical p... 27 6.5 Z81114-7|CAB03290.1| 702|Caenorhabditis elegans Hypothetical pr... 27 6.5 AF039042-4|AAC48247.2| 332|Caenorhabditis elegans Serpentine re... 27 8.6 AF016421-6|AAT92074.1| 984|Caenorhabditis elegans Hypothetical ... 27 8.6 AF016421-5|AAO12429.1| 1008|Caenorhabditis elegans Hypothetical ... 27 8.6 AF016421-4|AAC25789.1| 1067|Caenorhabditis elegans Hypothetical ... 27 8.6 AF016421-3|AAM45374.1| 1051|Caenorhabditis elegans Hypothetical ... 27 8.6 >U80441-8|AAB37656.1| 284|Caenorhabditis elegans Dumpy : shorter than wild-typeprotein 5 protein. Length = 284 Score = 29.1 bits (62), Expect = 1.6 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +2 Query: 56 EQGVPVQDGSSGLAVHKPGGTGTTASQRPRVS 151 +QG P QDG GLA PG G T +P V+ Sbjct: 183 DQGTPGQDGQPGLA-GPPGRDGLTGKGQPGVA 213 >U80028-9|AAN73867.1| 372|Caenorhabditis elegans Serpentine receptor, class w protein117 protein. Length = 372 Score = 28.7 bits (61), Expect = 2.1 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 196 YLVRLVQ*QYNSSMIRQRSCVRRREQATSVSKALANIP 309 ++ L+ QY ++I SC + TS SKA+ N+P Sbjct: 328 FICLLISSQYRKTIIHVLSCGFINSKKTSASKAVVNLP 365 >AF022967-1|AAY86215.1| 370|Caenorhabditis elegans Hypothetical protein C13A2.12 protein. Length = 370 Score = 27.5 bits (58), Expect = 4.9 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +3 Query: 297 REHSKITLTSYYKYKKINDTPSSKI 371 +++SK LTSY KY ++N T SK+ Sbjct: 4 KKNSKNILTSYAKYHELNATVISKV 28 >Z93385-10|CAB07643.1| 702|Caenorhabditis elegans Hypothetical protein M01E5.6 protein. Length = 702 Score = 27.1 bits (57), Expect = 6.5 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = +3 Query: 330 YKYKKINDTPSSKITTKTAEAENNDCNK 413 Y Y++++DT S + K AE+++ D N+ Sbjct: 467 YGYQELDDTMSEGLLEKEAESKHQDANE 494 >Z81114-7|CAB03290.1| 702|Caenorhabditis elegans Hypothetical protein M01E5.6 protein. Length = 702 Score = 27.1 bits (57), Expect = 6.5 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = +3 Query: 330 YKYKKINDTPSSKITTKTAEAENNDCNK 413 Y Y++++DT S + K AE+++ D N+ Sbjct: 467 YGYQELDDTMSEGLLEKEAESKHQDANE 494 >AF039042-4|AAC48247.2| 332|Caenorhabditis elegans Serpentine receptor, class i protein27 protein. Length = 332 Score = 26.6 bits (56), Expect = 8.6 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = -1 Query: 305 MFASALLTDVACSRRLTHER*RIIDELYCYWTKRTK*LRDFIPLPLSGK 159 +F A+ + S HE+ RI++ELY + + LR+F P++ K Sbjct: 148 LFPFAIAFSIYRSGDTLHEQMRILEELYPEYAGQFGNLREFQYYPMNNK 196 >AF016421-6|AAT92074.1| 984|Caenorhabditis elegans Hypothetical protein F44E7.4d protein. Length = 984 Score = 26.6 bits (56), Expect = 8.6 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = +3 Query: 12 TRFLSITSPLIKPFLNKVFLSRTAHQDSPFINLAGPEPL 128 TR +SI+ P P LN FLS+ H S I GP L Sbjct: 332 TRLVSISFPF--PDLNGEFLSQPGHYISHLIGHEGPGSL 368 >AF016421-5|AAO12429.1| 1008|Caenorhabditis elegans Hypothetical protein F44E7.4c protein. Length = 1008 Score = 26.6 bits (56), Expect = 8.6 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = +3 Query: 12 TRFLSITSPLIKPFLNKVFLSRTAHQDSPFINLAGPEPL 128 TR +SI+ P P LN FLS+ H S I GP L Sbjct: 273 TRLVSISFPF--PDLNGEFLSQPGHYISHLIGHEGPGSL 309 >AF016421-4|AAC25789.1| 1067|Caenorhabditis elegans Hypothetical protein F44E7.4a protein. Length = 1067 Score = 26.6 bits (56), Expect = 8.6 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = +3 Query: 12 TRFLSITSPLIKPFLNKVFLSRTAHQDSPFINLAGPEPL 128 TR +SI+ P P LN FLS+ H S I GP L Sbjct: 332 TRLVSISFPF--PDLNGEFLSQPGHYISHLIGHEGPGSL 368 >AF016421-3|AAM45374.1| 1051|Caenorhabditis elegans Hypothetical protein F44E7.4b protein. Length = 1051 Score = 26.6 bits (56), Expect = 8.6 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = +3 Query: 12 TRFLSITSPLIKPFLNKVFLSRTAHQDSPFINLAGPEPL 128 TR +SI+ P P LN FLS+ H S I GP L Sbjct: 332 TRLVSISFPF--PDLNGEFLSQPGHYISHLIGHEGPGSL 368 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,570,812 Number of Sequences: 27780 Number of extensions: 216680 Number of successful extensions: 605 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 589 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 605 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 809909048 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -