BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1201 (720 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 24 1.3 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 24 1.7 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 24 1.7 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 24 1.7 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 24 1.7 EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholi... 23 2.9 EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholi... 23 2.9 EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholi... 23 2.9 EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholi... 23 2.9 EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholi... 23 2.9 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 23 2.9 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 23 2.9 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 23 2.9 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 5.1 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 8.9 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 24.2 bits (50), Expect = 1.3 Identities = 11/29 (37%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = -1 Query: 675 FFNILYKLLNSQKSLIYFTIVR-DFKQIL 592 F+N++YKL+++ K IY + D ++IL Sbjct: 558 FYNVVYKLIDNIKKEIYDILPEVDVEEIL 586 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 330 LTAL*IWFSVCTCF 371 LTA+ +W VC CF Sbjct: 360 LTAMNVWDGVCMCF 373 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 330 LTAL*IWFSVCTCF 371 LTA+ +W VC CF Sbjct: 329 LTAMNVWDGVCMCF 342 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 330 LTAL*IWFSVCTCF 371 LTA+ +W VC CF Sbjct: 380 LTAMNVWDGVCMCF 393 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 330 LTAL*IWFSVCTCF 371 LTA+ +W VC CF Sbjct: 329 LTAMNVWDGVCMCF 342 >EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 6 protein. Length = 461 Score = 23.0 bits (47), Expect = 2.9 Identities = 7/12 (58%), Positives = 11/12 (91%) Frame = -1 Query: 600 QILFVKWRPCLL 565 ++LF++W PCLL Sbjct: 296 KMLFLQWLPCLL 307 >EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 5 protein. Length = 461 Score = 23.0 bits (47), Expect = 2.9 Identities = 7/12 (58%), Positives = 11/12 (91%) Frame = -1 Query: 600 QILFVKWRPCLL 565 ++LF++W PCLL Sbjct: 296 KMLFLQWLPCLL 307 >EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 4 protein. Length = 461 Score = 23.0 bits (47), Expect = 2.9 Identities = 7/12 (58%), Positives = 11/12 (91%) Frame = -1 Query: 600 QILFVKWRPCLL 565 ++LF++W PCLL Sbjct: 296 KMLFLQWLPCLL 307 >EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 3 protein. Length = 461 Score = 23.0 bits (47), Expect = 2.9 Identities = 7/12 (58%), Positives = 11/12 (91%) Frame = -1 Query: 600 QILFVKWRPCLL 565 ++LF++W PCLL Sbjct: 296 KMLFLQWLPCLL 307 >EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 2 protein. Length = 461 Score = 23.0 bits (47), Expect = 2.9 Identities = 7/12 (58%), Positives = 11/12 (91%) Frame = -1 Query: 600 QILFVKWRPCLL 565 ++LF++W PCLL Sbjct: 296 KMLFLQWLPCLL 307 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 23.0 bits (47), Expect = 2.9 Identities = 7/12 (58%), Positives = 11/12 (91%) Frame = -1 Query: 600 QILFVKWRPCLL 565 ++LF++W PCLL Sbjct: 296 KMLFLQWLPCLL 307 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 23.0 bits (47), Expect = 2.9 Identities = 7/12 (58%), Positives = 11/12 (91%) Frame = -1 Query: 600 QILFVKWRPCLL 565 ++LF++W PCLL Sbjct: 364 KMLFLQWLPCLL 375 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 23.0 bits (47), Expect = 2.9 Identities = 7/12 (58%), Positives = 11/12 (91%) Frame = -1 Query: 600 QILFVKWRPCLL 565 ++LF++W PCLL Sbjct: 364 KMLFLQWLPCLL 375 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.2 bits (45), Expect = 5.1 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 280 HQ*SFGPNLTTAELHN 327 H+ FG L TAE+HN Sbjct: 1114 HEDIFGITLRTAEVHN 1129 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.4 bits (43), Expect = 8.9 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -1 Query: 633 LIYFTIVRDFKQILFVKWRPCLLFEFVISFI 541 L+YF + R L + PC+L V+S++ Sbjct: 204 LVYFHLQRHMGNFLIQVYGPCVLL-VVLSWV 233 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,197 Number of Sequences: 438 Number of extensions: 3626 Number of successful extensions: 19 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -