BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1200 (663 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC017959-1|AAH17959.1| 291|Homo sapiens chromosome 2 open readi... 57 5e-08 AK026208-1|BAB15393.1| 291|Homo sapiens protein ( Homo sapiens ... 57 5e-08 AC097717-3|AAY24163.1| 291|Homo sapiens unknown protein. 57 5e-08 >BC017959-1|AAH17959.1| 291|Homo sapiens chromosome 2 open reading frame 47 protein. Length = 291 Score = 57.2 bits (132), Expect = 5e-08 Identities = 33/87 (37%), Positives = 48/87 (55%), Gaps = 3/87 (3%) Frame = +2 Query: 254 NVKNWMFSN---FIIRPYFDQEFSLNEFIEASKHAVQIVSGALQNSDFKTLEGLVDKDAI 424 N NW+ + F+I YFD+EFS+ EF E +K A VS L F LE LV K+ + Sbjct: 117 NPINWVRTRIKAFLIWAYFDKEFSITEFSEGAKQAFAHVSKLLSQCKFDLLEELVAKEVL 176 Query: 425 NALKTAVSQLSVSQRQLLAIEKEDIFY 505 +ALK V+ L + + LA ++I + Sbjct: 177 HALKEKVTSLPDNHKNALAANIDEIVF 203 >AK026208-1|BAB15393.1| 291|Homo sapiens protein ( Homo sapiens cDNA: FLJ22555 fis, clone HSI01193. ). Length = 291 Score = 57.2 bits (132), Expect = 5e-08 Identities = 33/87 (37%), Positives = 48/87 (55%), Gaps = 3/87 (3%) Frame = +2 Query: 254 NVKNWMFSN---FIIRPYFDQEFSLNEFIEASKHAVQIVSGALQNSDFKTLEGLVDKDAI 424 N NW+ + F+I YFD+EFS+ EF E +K A VS L F LE LV K+ + Sbjct: 117 NPINWVRTRIKAFLIWAYFDKEFSITEFSEGAKQAFAHVSKLLSQCKFDLLEELVAKEVL 176 Query: 425 NALKTAVSQLSVSQRQLLAIEKEDIFY 505 +ALK V+ L + + LA ++I + Sbjct: 177 HALKEKVTSLPDNHKNALAANIDEIVF 203 >AC097717-3|AAY24163.1| 291|Homo sapiens unknown protein. Length = 291 Score = 57.2 bits (132), Expect = 5e-08 Identities = 33/87 (37%), Positives = 48/87 (55%), Gaps = 3/87 (3%) Frame = +2 Query: 254 NVKNWMFSN---FIIRPYFDQEFSLNEFIEASKHAVQIVSGALQNSDFKTLEGLVDKDAI 424 N NW+ + F+I YFD+EFS+ EF E +K A VS L F LE LV K+ + Sbjct: 117 NPINWVRTRIKAFLIWAYFDKEFSITEFSEGAKQAFAHVSKLLSQCKFDLLEELVAKEVL 176 Query: 425 NALKTAVSQLSVSQRQLLAIEKEDIFY 505 +ALK V+ L + + LA ++I + Sbjct: 177 HALKEKVTSLPDNHKNALAANIDEIVF 203 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,715,504 Number of Sequences: 237096 Number of extensions: 1797189 Number of successful extensions: 3561 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3249 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3558 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7478817430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -