BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1200 (663 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 25 0.49 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 25 0.49 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 21 7.9 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 21 7.9 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 25.4 bits (53), Expect = 0.49 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +3 Query: 105 IAYNNGQKQIAITSKCPIIQYRKYSEQGTE 194 +A + + + CP +YR Y++ G+E Sbjct: 249 VAQDESTSLVCVAQACPTPEYRWYAQTGSE 278 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 25.4 bits (53), Expect = 0.49 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +3 Query: 105 IAYNNGQKQIAITSKCPIIQYRKYSEQGTE 194 +A + + + CP +YR Y++ G+E Sbjct: 249 VAQDESTSLVCVAQACPTPEYRWYAQTGSE 278 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 215 DGIPADNVAFIHKNV 259 + +P DNV F KNV Sbjct: 244 EAVPGDNVGFNVKNV 258 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 215 DGIPADNVAFIHKNV 259 + +P DNV F KNV Sbjct: 301 EAVPGDNVGFNVKNV 315 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,019 Number of Sequences: 438 Number of extensions: 4112 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19977660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -