BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1195 (756 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 23 2.0 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 23 2.0 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 2.6 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 2.6 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 8.0 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 21 8.0 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 21 8.0 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 23.4 bits (48), Expect = 2.0 Identities = 13/45 (28%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +3 Query: 231 NHC*RVAADDSGHAVHLPQWHRPYHPREA-WQGRRALHEDTASCG 362 NH + D G HLP H + P A +Q L ++ G Sbjct: 389 NHYGYHYSGDGGEVAHLPNTHMGHEPGAAYYQNENMLQKNAEYSG 433 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 23.4 bits (48), Expect = 2.0 Identities = 13/45 (28%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +3 Query: 231 NHC*RVAADDSGHAVHLPQWHRPYHPREA-WQGRRALHEDTASCG 362 NH + D G HLP H + P A +Q L ++ G Sbjct: 337 NHYGYHYSGDGGEVAHLPNTHMGHEPGAAYYQNENMLQKNAEYSG 381 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +3 Query: 285 QWHRPYHPREAWQGRRALH 341 QW +P PRE RR H Sbjct: 585 QWCKPCRPREQLTWRRNFH 603 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +3 Query: 285 QWHRPYHPREAWQGRRALH 341 QW +P PRE RR H Sbjct: 477 QWCKPCRPREQLTWRRNFH 495 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 8.0 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -1 Query: 315 LRADDMVCATEVDVPRARYRPPPLV-SSDS 229 +R + C TE DVP A LV S+DS Sbjct: 1187 VRTTPIHCQTEQDVPEAPIAVKALVMSTDS 1216 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 120 HLDAINCLST*SCQLIL 70 HL A N LS C+L+L Sbjct: 83 HLAAANILSPEDCELVL 99 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 120 HLDAINCLST*SCQLIL 70 HL A N LS C+L+L Sbjct: 83 HLAAANILSPEDCELVL 99 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,289 Number of Sequences: 336 Number of extensions: 4038 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -