BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1192 (425 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1294 - 36076524-36076554,36076821-36076891,36077221-360772... 49 2e-06 05_05_0108 + 22451440-22451541,22452228-22452427,22452979-22453018 48 4e-06 07_03_0078 - 13147741-13148913 30 0.68 >01_06_1294 - 36076524-36076554,36076821-36076891,36077221-36077275, 36077363-36077562,36078614-36078715 Length = 152 Score = 48.8 bits (111), Expect = 2e-06 Identities = 29/67 (43%), Positives = 36/67 (53%) Frame = +3 Query: 30 PRFEIAVGLRKGHKTTKISAGRKGITDKAIRIRPARLKGLQTKHSKFVRDLVREVVGHAQ 209 P+ + VG+ KGH TK + + RP+ KG TK FVR L+REVVG A Sbjct: 6 PKSGLFVGINKGHVVTK----------RELPPRPSDRKGKSTKRVNFVRGLIREVVGFAP 55 Query: 210 YEKRAME 230 YEKR E Sbjct: 56 YEKRITE 62 Score = 44.4 bits (100), Expect = 4e-05 Identities = 20/34 (58%), Positives = 27/34 (79%) Frame = +2 Query: 245 KRQGALKFLKRRLGTHIRAKRKREELSNVLAQMR 346 K + ALK KR+LGTH RAK+KREE++ V+ +MR Sbjct: 68 KDKRALKVAKRKLGTHKRAKKKREEMAGVIRKMR 101 >05_05_0108 + 22451440-22451541,22452228-22452427,22452979-22453018 Length = 113 Score = 47.6 bits (108), Expect = 4e-06 Identities = 28/67 (41%), Positives = 36/67 (53%) Frame = +3 Query: 30 PRFEIAVGLRKGHKTTKISAGRKGITDKAIRIRPARLKGLQTKHSKFVRDLVREVVGHAQ 209 P+ + VG+ KGH TK + + RP+ KG TK FVR+L+REV G A Sbjct: 6 PKSGLFVGINKGHVVTK----------RELPPRPSDRKGKSTKRVTFVRNLIREVAGFAP 55 Query: 210 YEKRAME 230 YEKR E Sbjct: 56 YEKRITE 62 Score = 45.2 bits (102), Expect = 2e-05 Identities = 21/34 (61%), Positives = 27/34 (79%) Frame = +2 Query: 245 KRQGALKFLKRRLGTHIRAKRKREELSNVLAQMR 346 K + ALK KR+LGTH RAK+KREE++ VL +MR Sbjct: 68 KDKRALKVAKRKLGTHKRAKKKREEMAGVLRKMR 101 >07_03_0078 - 13147741-13148913 Length = 390 Score = 30.3 bits (65), Expect = 0.68 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -2 Query: 133 AGLILMALSVIPLRPADILVVLWPF 59 AGL+ AL VIP P + +V WPF Sbjct: 71 AGLLYFALVVIPALPGVLRLVAWPF 95 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,630,314 Number of Sequences: 37544 Number of extensions: 164844 Number of successful extensions: 369 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 359 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 367 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 790518168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -