BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1192 (425 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35451| Best HMM Match : Ribosomal_L36e (HMM E-Value=0) 60 1e-09 >SB_35451| Best HMM Match : Ribosomal_L36e (HMM E-Value=0) Length = 100 Score = 59.7 bits (138), Expect = 1e-09 Identities = 33/63 (52%), Positives = 39/63 (61%) Frame = +3 Query: 42 IAVGLRKGHKTTKISAGRKGITDKAIRIRPARLKGLQTKHSKFVRDLVREVVGHAQYEKR 221 +AVGL+KGHK TK + +P+R KG K KFVRD+VREVVG A YEKR Sbjct: 1 MAVGLQKGHKVTK----------NVTKPKPSRRKGASNKRVKFVRDVVREVVGFAPYEKR 50 Query: 222 AME 230 ME Sbjct: 51 VME 53 Score = 53.6 bits (123), Expect = 7e-08 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +2 Query: 245 KRQGALKFLKRRLGTHIRAKRKREELSNVLAQMRK 349 K + ALKF K+RLGTH+R KRKREE+++VLA MRK Sbjct: 59 KDKRALKFCKKRLGTHVRGKRKREEITSVLAAMRK 93 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,208,218 Number of Sequences: 59808 Number of extensions: 203648 Number of successful extensions: 505 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 474 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 504 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 814166562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -