BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1191 (724 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|S... 26 4.7 SPAC26H5.12 |rpo41||mitochondrial DNA-directed RNA polymerase|Sc... 26 6.3 >SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|Schizosaccharomyces pombe|chr 1|||Manual Length = 2397 Score = 26.2 bits (55), Expect = 4.7 Identities = 16/64 (25%), Positives = 28/64 (43%) Frame = -1 Query: 343 VWKSVPLSVLNNSSIILQDGASIGTRYYDIIEQLYN*LKYAELGNLIYLMTRVVSDLTCL 164 +W S + + NNSS + D G R + + + + E G + + + DL C Sbjct: 1809 MWSSSDIRIPNNSSQLSIDSVRSGMRPFSLSKVPHQ--FDDEEGKALQIFREKLKDLNCK 1866 Query: 163 RSLN 152 S+N Sbjct: 1867 NSMN 1870 >SPAC26H5.12 |rpo41||mitochondrial DNA-directed RNA polymerase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1120 Score = 25.8 bits (54), Expect = 6.3 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = -1 Query: 346 EVWKSVPLSVLNNSSI-ILQDGASIGTRYYDIIEQLY 239 EVWKS SVLN ++ + ++ +S+ +Y +EQL+ Sbjct: 268 EVWKSEHESVLNRGNLQVPKNVSSLFYSWYVQLEQLF 304 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,610,628 Number of Sequences: 5004 Number of extensions: 49017 Number of successful extensions: 86 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 339215786 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -