BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1187 (752 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 82 3e-16 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 82 3e-16 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 82 3e-16 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 82 4e-16 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 82 4e-16 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 74 9e-14 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 73 2e-13 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 65 4e-11 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 65 4e-11 At3g16110.1 68416.m02035 thioredoxin family protein similar to p... 62 3e-10 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 62 5e-10 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 59 3e-09 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 57 1e-08 At4g27080.1 68417.m03893 thioredoxin family protein contains Pfa... 47 2e-05 At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chlorop... 42 3e-04 At2g01270.1 68415.m00040 thioredoxin family protein low similari... 42 4e-04 At4g37200.1 68417.m05266 thioredoxin family protein contains Pfa... 41 8e-04 At1g15020.2 68414.m01795 thioredoxin family protein low similari... 41 8e-04 At1g15020.1 68414.m01794 thioredoxin family protein low similari... 41 8e-04 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 38 0.005 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 38 0.005 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 38 0.007 At3g20560.1 68416.m02603 thioredoxin family protein contains Pfa... 38 0.009 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 38 0.009 At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / P... 37 0.012 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 37 0.012 At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 37 0.012 At1g50950.1 68414.m05728 thioredoxin-related contains weak hit t... 37 0.017 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 36 0.029 At4g04950.1 68417.m00719 thioredoxin family protein similar to P... 36 0.029 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 36 0.029 At1g34780.1 68414.m04329 protein disulfide isomerase-related con... 36 0.029 At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / P... 36 0.038 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 35 0.050 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 35 0.067 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 35 0.067 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 35 0.067 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 35 0.067 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 34 0.088 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 34 0.12 At3g19780.1 68416.m02504 expressed protein 33 0.20 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 33 0.20 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 33 0.27 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 32 0.36 At4g32580.1 68417.m04638 thioredoxin family protein contains Pfa... 32 0.47 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 32 0.47 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 31 0.82 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 31 1.1 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 31 1.1 At4g08930.1 68417.m01470 thioredoxin-related contains weak simil... 31 1.1 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 30 1.4 At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa... 30 1.4 At1g07960.3 68414.m00867 thioredoxin family protein low similari... 30 1.4 At1g07960.2 68414.m00866 thioredoxin family protein low similari... 30 1.4 At1g07960.1 68414.m00865 thioredoxin family protein low similari... 30 1.4 At1g04700.1 68414.m00467 protein kinase family protein low simil... 30 1.9 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 29 2.5 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 29 3.3 At1g60420.1 68414.m06802 DC1 domain-containing protein contains ... 29 4.4 At1g49900.1 68414.m05596 zinc finger (C2H2 type) family protein ... 28 5.8 At1g11530.1 68414.m01324 thioredoxin family protein similar to t... 28 5.8 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 28 7.7 At4g05490.1 68417.m00830 F-box family protein (FBL22) contains s... 28 7.7 At2g27350.3 68415.m03293 OTU-like cysteine protease family prote... 28 7.7 At2g27350.2 68415.m03292 OTU-like cysteine protease family prote... 28 7.7 At2g27350.1 68415.m03291 OTU-like cysteine protease family prote... 28 7.7 At1g26680.1 68414.m03250 transcriptional factor B3 family protei... 28 7.7 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 82.2 bits (194), Expect = 3e-16 Identities = 34/84 (40%), Positives = 57/84 (67%) Frame = +1 Query: 256 EESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 435 +E + LAK+DAT+E +LA+ Y V+G+PTL FF +G Y+GGR + I++W+KKK GP Sbjct: 150 KEDGVVLAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTGGRTKETIVTWVKKKIGP 209 Query: 436 PAVEVTSAEQAKELIDANTVIVFG 507 +T+ + A++++ + +V G Sbjct: 210 GVYNLTTLDDAEKVLTSGNKVVLG 233 Score = 79.8 bits (188), Expect = 2e-15 Identities = 37/69 (53%), Positives = 49/69 (71%), Gaps = 4/69 (5%) Frame = +2 Query: 74 LGLALGDEVPT----EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 241 LG D +PT E++V+V+ + NF VI +Y+LVEFYAPWCGHC+SLAPEYA AA Sbjct: 87 LGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYAAAA 146 Query: 242 TKLAEKNLL 268 T+L E ++ Sbjct: 147 TELKEDGVV 155 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/56 (42%), Positives = 36/56 (64%), Gaps = 3/56 (5%) Frame = +2 Query: 92 DEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 250 D +P +E+V ++ NF E V+ ++ +L+E YAPWCGHC++L P Y K A L Sbjct: 433 DPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMYNKLAKHL 488 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 82.2 bits (194), Expect = 3e-16 Identities = 34/84 (40%), Positives = 57/84 (67%) Frame = +1 Query: 256 EESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 435 +E + LAK+DAT+E +LA+ Y V+G+PTL FF +G Y+GGR + I++W+KKK GP Sbjct: 150 KEDGVVLAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTGGRTKETIVTWVKKKIGP 209 Query: 436 PAVEVTSAEQAKELIDANTVIVFG 507 +T+ + A++++ + +V G Sbjct: 210 GVYNLTTLDDAEKVLTSGNKVVLG 233 Score = 79.8 bits (188), Expect = 2e-15 Identities = 37/69 (53%), Positives = 49/69 (71%), Gaps = 4/69 (5%) Frame = +2 Query: 74 LGLALGDEVPT----EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 241 LG D +PT E++V+V+ + NF VI +Y+LVEFYAPWCGHC+SLAPEYA AA Sbjct: 87 LGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYAAAA 146 Query: 242 TKLAEKNLL 268 T+L E ++ Sbjct: 147 TELKEDGVV 155 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/56 (42%), Positives = 36/56 (64%), Gaps = 3/56 (5%) Frame = +2 Query: 92 DEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 250 D +P +E+V ++ NF E V+ ++ +L+E YAPWCGHC++L P Y K A L Sbjct: 433 DPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMYNKLAKHL 488 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 82.2 bits (194), Expect = 3e-16 Identities = 38/87 (43%), Positives = 61/87 (70%), Gaps = 4/87 (4%) Frame = +1 Query: 265 PIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTG 432 P+ LAK+DA++E ++ A Y ++G+PTLK RNG S DY+G R+A+ I+++LKK++G Sbjct: 81 PLALAKIDASEEANKEFANEYKIQGFPTLKILRNGGKSVQDYNGPREAEGIVTYLKKQSG 140 Query: 433 PPAVEVTSAEQAKELIDANTVIVFGSF 513 P +VE+ SA+ A E++ V+ G F Sbjct: 141 PASVEIKSADSATEVVGEKNVVAVGVF 167 Score = 73.3 bits (172), Expect = 2e-13 Identities = 34/71 (47%), Positives = 47/71 (66%), Gaps = 2/71 (2%) Frame = +2 Query: 56 FTAIALLGLALGD--EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 229 F+ + LL L + T+E VL L +NF I+ ++I+VEFYAPWCGHC+ LAPEY Sbjct: 9 FSILLLLSLFVSSIRSEETKEFVLTLDHSNFTETISKHDFIVVEFYAPWCGHCQKLAPEY 68 Query: 230 AKAATKLAEKN 262 KAA++L+ N Sbjct: 69 EKAASELSSHN 79 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/45 (42%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = +2 Query: 98 VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 223 +P E N +V++++ + V + + +L+EFYAPWCGHC+ LAP Sbjct: 366 IPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAP 410 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/53 (32%), Positives = 35/53 (66%), Gaps = 1/53 (1%) Frame = +1 Query: 274 LAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLKKKT 429 +AK+DAT ++++ V+G+PT+ F +G+ + Y G R +D I++++K + Sbjct: 427 IAKLDATANDIPSDTFDVKGFPTIYFRSASGNVVVYEGDRTKEDFINFVEKNS 479 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 81.8 bits (193), Expect = 4e-16 Identities = 37/87 (42%), Positives = 61/87 (70%), Gaps = 4/87 (4%) Frame = +1 Query: 265 PIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTG 432 P+ LAK+DA++E ++ A Y V+G+PT+K FRNG +Y+G R+A+ I+++LKK++G Sbjct: 82 PVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLKKQSG 141 Query: 433 PPAVEVTSAEQAKELIDANTVIVFGSF 513 P + E+ SA+ A E++ V+V G F Sbjct: 142 PASAEIKSADDASEVVSDKKVVVVGIF 168 Score = 73.7 bits (173), Expect = 1e-13 Identities = 36/72 (50%), Positives = 46/72 (63%), Gaps = 6/72 (8%) Frame = +2 Query: 56 FTAIALLGLAL------GDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 217 FT ++L L+L +E T+E VL L NF I ++I+VEFYAPWCGHCK L Sbjct: 6 FTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCGHCKQL 65 Query: 218 APEYAKAATKLA 253 APEY KAA+ L+ Sbjct: 66 APEYEKAASALS 77 Score = 48.0 bits (109), Expect = 7e-06 Identities = 20/45 (44%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = +2 Query: 98 VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 223 +P E N +V+S + + V+ + + +L+EFYAPWCGHC+ LAP Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAP 412 Score = 37.1 bits (82), Expect = 0.012 Identities = 16/55 (29%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Frame = +1 Query: 259 ESPIKLAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLK 420 +S + +AK+DAT +++ V+G+PT+ F +G+ + Y G RQ + + +++ Sbjct: 424 DSSVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRQRESLYLFIR 478 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 81.8 bits (193), Expect = 4e-16 Identities = 37/87 (42%), Positives = 61/87 (70%), Gaps = 4/87 (4%) Frame = +1 Query: 265 PIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTG 432 P+ LAK+DA++E ++ A Y V+G+PT+K FRNG +Y+G R+A+ I+++LKK++G Sbjct: 82 PVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLKKQSG 141 Query: 433 PPAVEVTSAEQAKELIDANTVIVFGSF 513 P + E+ SA+ A E++ V+V G F Sbjct: 142 PASAEIKSADDASEVVSDKKVVVVGIF 168 Score = 73.7 bits (173), Expect = 1e-13 Identities = 36/72 (50%), Positives = 46/72 (63%), Gaps = 6/72 (8%) Frame = +2 Query: 56 FTAIALLGLAL------GDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 217 FT ++L L+L +E T+E VL L NF I ++I+VEFYAPWCGHCK L Sbjct: 6 FTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCGHCKQL 65 Query: 218 APEYAKAATKLA 253 APEY KAA+ L+ Sbjct: 66 APEYEKAASALS 77 Score = 48.0 bits (109), Expect = 7e-06 Identities = 20/45 (44%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = +2 Query: 98 VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 223 +P E N +V+S + + V+ + + +L+EFYAPWCGHC+ LAP Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAP 412 Score = 45.6 bits (103), Expect = 4e-05 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 4/76 (5%) Frame = +1 Query: 259 ESPIKLAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLKKK--- 426 +S + +AK+DAT +++ V+G+PT+ F +G+ + Y G R +D IS++ K Sbjct: 424 DSSVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRTKEDFISFVDKNKDT 483 Query: 427 TGPPAVEVTSAEQAKE 474 G P E + E+ K+ Sbjct: 484 VGEPKKEEETTEEVKD 499 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 74.1 bits (174), Expect = 9e-14 Identities = 34/79 (43%), Positives = 51/79 (64%), Gaps = 1/79 (1%) Frame = +1 Query: 274 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKKTGPPAVEV 450 LAK+DAT+E DLA+ Y ++G+PT+ F +G Y G R D I++WLKKK P + Sbjct: 151 LAKIDATEEGDLAQKYEIQGFPTVFLFVDGEMRKTYEGERTKDGIVTWLKKKASPSIHNI 210 Query: 451 TSAEQAKELIDANTVIVFG 507 T+ E+A+ ++ A +VFG Sbjct: 211 TTKEEAERVLSAEPKLVFG 229 Score = 63.7 bits (148), Expect = 1e-10 Identities = 26/48 (54%), Positives = 35/48 (72%) Frame = +2 Query: 107 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 250 E++V VL+K NF + + +VEFYAPWCG C++L PEYA AAT+L Sbjct: 98 EKDVAVLTKDNFTEFVGNNSFAMVEFYAPWCGACQALTPEYAAAATEL 145 Score = 47.2 bits (107), Expect = 1e-05 Identities = 27/72 (37%), Positives = 39/72 (54%), Gaps = 3/72 (4%) Frame = +2 Query: 29 DNIEMRVLIFTAIALLGLALGDEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWC 199 +NI+ F A L D +P + +V V+ NF E V+ ++ +L+E YAPWC Sbjct: 408 NNIKTLAEDFLADKLKPFYKSDPLPENNDGDVKVIVGNNFDEIVLDESKDVLLEIYAPWC 467 Query: 200 GHCKSLAPEYAK 235 GHC+S P Y K Sbjct: 468 GHCQSFEPIYNK 479 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 72.9 bits (171), Expect = 2e-13 Identities = 29/84 (34%), Positives = 50/84 (59%) Frame = +1 Query: 262 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 441 S + +AK+D + +A ++G+PTL F NG+ + Y+GG A+DI+ W++KKTG P Sbjct: 128 SSVLMAKIDGDRYSKIASELEIKGFPTLLLFVNGTSLTYNGGSSAEDIVIWVQKKTGAPI 187 Query: 442 VEVTSAEQAKELIDANTVIVFGSF 513 + + + ++A +D V G F Sbjct: 188 ITLNTVDEAPRFLDKYHTFVLGLF 211 Score = 41.5 bits (93), Expect = 6e-04 Identities = 20/47 (42%), Positives = 27/47 (57%) Frame = +2 Query: 116 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 256 VL L+ + VI E+++V YAPWC L P +A+AAT L E Sbjct: 79 VLELNGDYTKRVIDGNEFVMVLGYAPWCARSAELMPRFAEAATALKE 125 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = +2 Query: 110 ENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 244 +NV+VL+ NF E V+ + +LVEFYAPWCGHCKSLAP Y K AT Sbjct: 141 QNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVAT 186 Score = 62.5 bits (145), Expect = 3e-10 Identities = 35/75 (46%), Positives = 47/75 (62%), Gaps = 2/75 (2%) Frame = +2 Query: 53 IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 232 I+ ALL L L V ++V+VL+ +FE + + LVEFYAPWCGHCK LAPEY Sbjct: 6 IWFGFALLALLLVSAVA--DDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYE 63 Query: 233 K--AATKLAEKNLLS 271 K A+ K A+ L++ Sbjct: 64 KLGASFKKAKSVLIA 78 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/61 (44%), Positives = 39/61 (63%), Gaps = 2/61 (3%) Frame = +1 Query: 256 EESPIKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKKKT 429 +E + +A +DA + L E YGV G+PTLKFF N + DY GGR DD +S++ +K+ Sbjct: 190 QEEGVVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKS 249 Query: 430 G 432 G Sbjct: 250 G 250 Score = 48.0 bits (109), Expect = 7e-06 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 2/57 (3%) Frame = +1 Query: 268 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 432 + +AKVD +++ + YGV GYPT+++F GS P Y G R A+ + ++ K+ G Sbjct: 75 VLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGG 131 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = +2 Query: 110 ENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 244 +NV+VL+ NF E V+ + +LVEFYAPWCGHCKSLAP Y K AT Sbjct: 141 QNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVAT 186 Score = 62.5 bits (145), Expect = 3e-10 Identities = 35/75 (46%), Positives = 47/75 (62%), Gaps = 2/75 (2%) Frame = +2 Query: 53 IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 232 I+ ALL L L V ++V+VL+ +FE + + LVEFYAPWCGHCK LAPEY Sbjct: 6 IWFGFALLALLLVSAVA--DDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYE 63 Query: 233 K--AATKLAEKNLLS 271 K A+ K A+ L++ Sbjct: 64 KLGASFKKAKSVLIA 78 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/61 (44%), Positives = 39/61 (63%), Gaps = 2/61 (3%) Frame = +1 Query: 256 EESPIKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKKKT 429 +E + +A +DA + L E YGV G+PTLKFF N + DY GGR DD +S++ +K+ Sbjct: 190 QEEGVVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKS 249 Query: 430 G 432 G Sbjct: 250 G 250 Score = 48.0 bits (109), Expect = 7e-06 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 2/57 (3%) Frame = +1 Query: 268 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 432 + +AKVD +++ + YGV GYPT+++F GS P Y G R A+ + ++ K+ G Sbjct: 75 VLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGG 131 >At3g16110.1 68416.m02035 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 534 Score = 62.5 bits (145), Expect = 3e-10 Identities = 24/84 (28%), Positives = 49/84 (58%) Frame = +1 Query: 262 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 441 S + +AK+D + +A ++G+PTL F NG+ Y+GG +++I+ W++KKTG Sbjct: 126 SSVLMAKIDGERYSKVASQLEIKGFPTLLLFVNGTSQSYTGGFSSEEIVIWVQKKTGAST 185 Query: 442 VEVTSAEQAKELIDANTVIVFGSF 513 +++ + ++A + + + G F Sbjct: 186 IKLDTVDEASGFLKKHHTFILGLF 209 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/47 (42%), Positives = 28/47 (59%) Frame = +2 Query: 116 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 256 V+ L+ N + +I EY++V YAPWC L P +A+AAT L E Sbjct: 77 VVELNGDNTKRLIDGNEYVMVLGYAPWCARSAELMPRFAEAATDLKE 123 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 61.7 bits (143), Expect = 5e-10 Identities = 27/55 (49%), Positives = 37/55 (67%) Frame = +2 Query: 92 DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 256 D+ + VL L+ +NF++ I+T + I V+FYAPWCGHCK L PE AA LA+ Sbjct: 26 DQFTLDGTVLELTDSNFDSAISTFDCIFVDFYAPWCGHCKRLNPELDAAAPILAK 80 Score = 54.4 bits (125), Expect = 8e-08 Identities = 27/79 (34%), Positives = 44/79 (55%), Gaps = 1/79 (1%) Frame = +1 Query: 259 ESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPP 438 + PI +AK++A + LA + +PTL + +G P++Y G R+AD ++ +LKK P Sbjct: 82 KQPIVIAKLNADKYSRLARKIEIDAFPTLMLYNHGVPMEYYGPRKADLLVRYLKKFVAPD 141 Query: 439 AVEVTSAEQAKELI-DANT 492 + S KE + DA T Sbjct: 142 VAVLESDSTVKEFVEDAGT 160 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 59.3 bits (137), Expect = 3e-09 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = +2 Query: 125 LSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKLAEK 259 L+ +NF+ ++T ++ + +VEF+APWCGHCK LAPE+ KAA L K Sbjct: 168 LNSSNFDELVTESKELWIVEFFAPWCGHCKKLAPEWKKAANNLKGK 213 Score = 54.8 bits (126), Expect = 6e-08 Identities = 23/46 (50%), Positives = 34/46 (73%), Gaps = 1/46 (2%) Frame = +2 Query: 116 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 250 VL L+ +NF++ V+ + +LVEF+APWCGHC+SL P + K A+ L Sbjct: 30 VLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEKVASTL 75 Score = 47.6 bits (108), Expect = 9e-06 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +1 Query: 274 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKK 426 +A +DA + +++ YGVRG+PT+K F G PIDY G R A I + K+ Sbjct: 81 VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSISQFAIKQ 132 Score = 40.7 bits (91), Expect = 0.001 Identities = 27/88 (30%), Positives = 40/88 (45%), Gaps = 6/88 (6%) Frame = +1 Query: 268 IKLAKVDATQEQDLAESYGVRGYPTLKFFRN--GSPIDYSGGRQADDIISW----LKKKT 429 +KL V+ EQ + + V+G+PT+ F + SP+ Y G R A I S+ L+ Sbjct: 214 VKLGHVNCDAEQSIKSRFKVQGFPTILVFGSDKSSPVPYEGARSASAIESFALEQLESNA 273 Query: 430 GPPAVEVTSAEQAKELIDANTVIVFGSF 513 GP V + E + I F SF Sbjct: 274 GPAEVTELTGPDVMEDKCGSAAICFVSF 301 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 56.8 bits (131), Expect = 1e-08 Identities = 25/46 (54%), Positives = 33/46 (71%), Gaps = 1/46 (2%) Frame = +2 Query: 125 LSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEK 259 L+ +NF+ VI + E +VEF+APWCGHCK LAPE+ +AA L K Sbjct: 167 LNASNFDDLVIESNELWIVEFFAPWCGHCKKLAPEWKRAAKNLQGK 212 Score = 52.8 bits (121), Expect = 2e-07 Identities = 22/46 (47%), Positives = 33/46 (71%), Gaps = 1/46 (2%) Frame = +2 Query: 116 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 250 V+ L+ +NF++ V+ + +LVEF+APWCGHCK+L P + K A L Sbjct: 32 VVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVANIL 77 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = +1 Query: 274 LAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISWLKKK 426 +A +DA Q A+ YG++G+PT+K F G +PIDY G R A I ++ K+ Sbjct: 83 VAAIDADAHQSAAQDYGIKGFPTIKVFVPGKAPIDYQGARDAKSIANFAYKQ 134 Score = 37.5 bits (83), Expect = 0.009 Identities = 26/91 (28%), Positives = 39/91 (42%), Gaps = 6/91 (6%) Frame = +1 Query: 259 ESPIKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISW----LK 420 + +KL V+ EQ + + V+G+PT+ F SP Y G R A I S+ ++ Sbjct: 210 QGKVKLGHVNCDVEQSIMSRFKVQGFPTILVFGPDKSSPYPYEGARSASAIESFASELVE 269 Query: 421 KKTGPPAVEVTSAEQAKELIDANTVIVFGSF 513 GP V + E + I F SF Sbjct: 270 SSAGPVEVTELTGPDVMEKKCGSAAICFISF 300 >At4g27080.1 68417.m03893 thioredoxin family protein contains Pfam PF00085: Thioredoxin Length = 480 Score = 46.8 bits (106), Expect = 2e-05 Identities = 23/59 (38%), Positives = 33/59 (55%), Gaps = 2/59 (3%) Frame = +2 Query: 89 GDEVPTE--ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEK 259 GDE E E+ + L+ NF+T ++V FYAPWC C L P + KAA ++ E+ Sbjct: 132 GDETGEEIVEDSVPLTGRNFDTFTHQFPILVVNFYAPWCYWCNLLKPSWEKAAKQIKER 190 Score = 41.1 bits (92), Expect = 8e-04 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = +1 Query: 274 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 372 LAKVD TQE DL ++GYP+++ FR GS + Sbjct: 201 LAKVDCTQEGDLCRRNHIQGYPSIRIFRKGSDL 233 >At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chloroplast (APR2) (APSR) / adenosine 5'-phosphosulfate 5'-adenylylsulfate (APS) sulfotransferase 2 / 3'-phosphoadenosine-5'-phosphosulfate (PAPS) reductase homolog 43 (PRH-43) identical to SP|P92981 5'-adenylylsulfate reductase 2, chloroplast precursor (EC 1.8.4.9) (Adenosine 5'-phosphosulfate 5'-adenylylsulfate sulfotransferase 2) (APS sulfotransferase 2) (Thioredoxin independent APS reductase 2) (3'-phosphoadenosine-5'-phosphosulfate reductase homolog 43) (PAPS reductase homolog 43) (Prh-43) {Arabidopsis thaliana}; identical to cDNA PAPS reductase homolog (PRH43) GI:1710115 Length = 454 Score = 42.3 bits (95), Expect = 3e-04 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 3/60 (5%) Frame = +2 Query: 95 EVPTEENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEKNL 265 E+ NV+ LSK E ++ E LV YAPWC C+++ Y + A KLA K + Sbjct: 337 EIFESNNVVALSKGGVENLLKLENRKEAWLVVLYAPWCPFCQAMEASYIELAEKLAGKGV 396 >At2g01270.1 68415.m00040 thioredoxin family protein low similarity to quiescin [Homo sapiens] GI:13257405; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 495 Score = 41.9 bits (94), Expect = 4e-04 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +2 Query: 107 EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAPEYAKAA 241 ++ + L+ NF++V+ T +Y +VEF+A WC C++ P Y K A Sbjct: 34 KDKAVELNTTNFDSVLKDTPAKYAVVEFFAHWCPACRNYKPHYEKVA 80 >At4g37200.1 68417.m05266 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin-like protein (hcf164 gene) GI;12049652 Length = 261 Score = 41.1 bits (92), Expect = 8e-04 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 2/78 (2%) Frame = +2 Query: 32 NIEMRVLIFTAIALLGLALGDEVPTEENV--LVLSKANFETVITTTEYILVEFYAPWCGH 205 +I RV T IA L L + + ++ L S +E ++ + +VEFYA WC Sbjct: 93 DINRRVAAVTVIAALSLFVSTRLDFGISLKDLTASALPYEEALSNGKPTVVEFYADWCEV 152 Query: 206 CKSLAPEYAKAATKLAEK 259 C+ LAP+ K + +K Sbjct: 153 CRELAPDVYKIEQQYKDK 170 >At1g15020.2 68414.m01795 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 528 Score = 41.1 bits (92), Expect = 8e-04 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +2 Query: 107 EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAPEYAKAA 241 ++N + L+ NF++V + +Y ++EF+A WC C++ P Y K A Sbjct: 40 KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVA 86 >At1g15020.1 68414.m01794 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 502 Score = 41.1 bits (92), Expect = 8e-04 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +2 Query: 107 EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAPEYAKAA 241 ++N + L+ NF++V + +Y ++EF+A WC C++ P Y K A Sbjct: 40 KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVA 86 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 38.3 bits (85), Expect = 0.005 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +2 Query: 125 LSKANFETVITTTEY-ILVEFYAPWCGHCKSLAPEYAKAATKLAEK 259 LS + ++T + ++ +LVEF+APWCG C+ + P + A A K Sbjct: 91 LSDSEWQTKVLESDVPVLVEFWAPWCGPCRMIHPIVDQLAKDFAGK 136 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 271 KLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID 375 K K++ + + A YG+R PT+ F+ G D Sbjct: 138 KFYKINTDESPNTANRYGIRSVPTVIIFKGGEKKD 172 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 38.3 bits (85), Expect = 0.005 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = +2 Query: 104 TEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 253 T + V++ + +++ V+ E + V+F+APWCG CK + P + A K A Sbjct: 72 TATGIPVVNDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDPIVNELAQKYA 122 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 37.9 bits (84), Expect = 0.007 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +2 Query: 131 KANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 256 K+ + T + +++EF A WCG CK+L P+ + A K + Sbjct: 49 KSRLNALKDTNKLLVIEFTAKWCGPCKTLEPKLEELAAKYTD 90 >At3g20560.1 68416.m02603 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 483 Score = 37.5 bits (83), Expect = 0.009 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 2/69 (2%) Frame = +2 Query: 59 TAIALLGLALGDEVPTE--ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 232 + +AL + G+E E + + L+ A+FE + ++V F APWC L P + Sbjct: 122 SGLALHNINHGEETKEEFPDGAIPLTSASFEALSHHFPILVVNFNAPWCYWSNRLKPSWE 181 Query: 233 KAATKLAEK 259 KAA + ++ Sbjct: 182 KAANIIKQR 190 Score = 35.5 bits (78), Expect = 0.038 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 10/66 (15%) Frame = +1 Query: 268 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI----------DYSGGRQADDIISWL 417 + L VD T+E L + ++GYP+++ FR GS + Y G R D I+ + Sbjct: 199 VLLGNVDCTEEPALCKRNHIQGYPSIRIFRKGSDLREDHGHHEHESYYGDRDTDSIVKMV 258 Query: 418 KKKTGP 435 + P Sbjct: 259 EGLVAP 264 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 37.5 bits (83), Expect = 0.009 Identities = 13/42 (30%), Positives = 28/42 (66%) Frame = +2 Query: 131 KANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 256 K+ F+++ + + ++++F A WCG CK++ P + A+K +E Sbjct: 33 KSLFDSMKGSNKLLVIDFTAVWCGPCKAMEPRVREIASKYSE 74 >At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / PAPS reductase homolog (PRH19) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738756; identical to cDNA PAPS reductase homolog (PRH19) GI:1710111 Length = 465 Score = 37.1 bits (82), Expect = 0.012 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Frame = +2 Query: 110 ENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 253 EN++ LS+ E ++ E +V YAPWC C+++ Y + A KLA Sbjct: 353 ENLVTLSRQGIENLMKLENRKEPWIVVLYAPWCPFCQAMEASYDELADKLA 403 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 37.1 bits (82), Expect = 0.012 Identities = 14/41 (34%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = +2 Query: 104 TEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAP 223 T ++ V++ + +++ V+ T ++V+F+APWCG CK + P Sbjct: 78 TTTDIQVVNDSTWDSLVLKATGPVVVDFWAPWCGPCKMIDP 118 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 37.1 bits (82), Expect = 0.012 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = +1 Query: 280 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 432 KVD + Q +A+ +GV PT F + G +D G +D+ + + K TG Sbjct: 65 KVDVDELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGANKEDLQAKIVKHTG 115 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 158 TTEYILVEFYAPWCGHCKSLAPEYAKAATK 247 + + I+++F A WC C+ +AP + A K Sbjct: 27 SNKLIVIDFTASWCPPCRMIAPIFNDLAKK 56 >At1g50950.1 68414.m05728 thioredoxin-related contains weak hit to Pfam PF00085: Thioredoxin; contains 2 predicted transmembrane domains Length = 484 Score = 36.7 bits (81), Expect = 0.017 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 10/66 (15%) Frame = +1 Query: 268 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI----------DYSGGRQADDIISWL 417 + L VD T+E L +S ++GYP+++ FR GS + Y G R D ++ + Sbjct: 200 VLLGSVDCTEEPTLCKSNHIQGYPSIRIFRRGSGLREDHGNHEHESYYGDRDTDSLVKMV 259 Query: 418 KKKTGP 435 ++ P Sbjct: 260 EELLKP 265 Score = 34.3 bits (75), Expect = 0.088 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 125 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEK 259 L+ A FE + ++V FYAPWC L P + KA+ E+ Sbjct: 147 LTGAAFEKFTHHFQILVVNFYAPWCYWSNRLKPSWVKASQITRER 191 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 3/52 (5%) Frame = +2 Query: 95 EVPTEENVLVLSKANF--ETVITTTEYILV-EFYAPWCGHCKSLAPEYAKAA 241 E T N+L + AN ++++ + ++V +FY+P CG CKSL P+ + A Sbjct: 80 EKSTNHNMLEIQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPKICQLA 131 >At4g04950.1 68417.m00719 thioredoxin family protein similar to PKCq-interacting protein PICOT from [Mus musculus] GI:6840949, [Rattus norvegicus] GI:6840951; contains Pfam profile PF00085: Thioredoxin Length = 488 Score = 35.9 bits (79), Expect = 0.029 Identities = 23/63 (36%), Positives = 33/63 (52%) Frame = +1 Query: 280 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 459 +V+A + +++E+Y V P FF++G +D G AD S L K G A TSA Sbjct: 57 RVEAEEHPEISEAYSVAAVPYFVFFKDGKTVDTLEG--ADP--SSLANKVGKVAGSSTSA 112 Query: 460 EQA 468 E A Sbjct: 113 EPA 115 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 35.9 bits (79), Expect = 0.029 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 146 TVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEK 259 TV+ + + +LVEF A WCG CK + P + + +K Sbjct: 82 TVLESAQPVLVEFVATWCGPCKLIYPAMEALSQEYGDK 119 >At1g34780.1 68414.m04329 protein disulfide isomerase-related contains weak similarity to Pfam:P08003 protein disulfide isomerase A4 precursor (Protein ERp-72, ERp72) [Mus musculus] Length = 310 Score = 35.9 bits (79), Expect = 0.029 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +1 Query: 319 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQA 468 YGV G+PTL + Y G R D ++++ TG ++ TS E++ Sbjct: 131 YGVHGFPTLLLLNSTMRARYRGTRMLDSLVAFYSDVTGIETLDKTSLERS 180 >At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / PAPS reductase homolog (PRH26) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738760; identical to cDNA PAPS reductase homolog (PRH26) GI:1710113 Length = 458 Score = 35.5 bits (78), Expect = 0.038 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 3/61 (4%) Frame = +2 Query: 77 GLALGDEVPTEENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEYAKAATK 247 G A ++ ENV+ LS+ E ++ E +V YAPWC C+++ + + A K Sbjct: 335 GTASVADIFNSENVVNLSRQGIENLMKLENRKEAWIVVLYAPWCPFCQAMEASFDELADK 394 Query: 248 L 250 L Sbjct: 395 L 395 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 35.1 bits (77), Expect = 0.050 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +2 Query: 170 ILVEFYAPWCGHCKSLAPEYAKAATKL 250 ++V+F A WCG C+ +AP +A A KL Sbjct: 31 VVVDFTASWCGPCRFIAPFFADLAKKL 57 Score = 31.1 bits (67), Expect = 0.82 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = +1 Query: 280 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 423 KVD + + +A + ++ PT F + G +D G + D++ S + K Sbjct: 64 KVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAK 111 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 34.7 bits (76), Expect = 0.067 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 170 ILVEFYAPWCGHCKSLAPEYAKAATK 247 ++VEFY WC C++L P+ K A + Sbjct: 126 VIVEFYGTWCASCRALFPKLCKTAVE 151 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 34.7 bits (76), Expect = 0.067 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 170 ILVEFYAPWCGHCKSLAPEYAKAATK 247 ++VEFY WC C++L P+ K A + Sbjct: 126 VIVEFYGTWCASCRALFPKLCKTAVE 151 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 34.7 bits (76), Expect = 0.067 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +2 Query: 170 ILVEFYAPWCGHCKSLAPEYAKAA 241 ++V+FY WCG C+++ P+ K A Sbjct: 116 VIVDFYGTWCGSCRAMFPKLCKTA 139 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +1 Query: 412 WLKKKTGPPAVEVTSAEQ-AKELIDANTVIVFGSF 513 W ++K GP +++TSAEQ L DA +V F Sbjct: 86 WWERKAGPNMIDITSAEQFLNALKDAGDRLVIVDF 120 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 34.7 bits (76), Expect = 0.067 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +2 Query: 170 ILVEFYAPWCGHCKSLAPEYAKAATKLAEKNLL 268 ++V+F++P CG CK+L P+ K A K E L Sbjct: 116 VVVDFFSPSCGGCKALHPKICKIAEKNPEVEFL 148 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 34.3 bits (75), Expect = 0.088 Identities = 13/42 (30%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = +2 Query: 137 NFETVITTTEY-ILVEFYAPWCGHCKSLAPEYAKAATKLAEK 259 +FE ++ ++ +LV++YA WCG C+ + P + + L +K Sbjct: 72 SFEDLLVNSDKPVLVDYYATWCGPCQFMVPILNEVSETLKDK 113 Score = 32.3 bits (70), Expect = 0.36 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +1 Query: 268 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDII 408 I++ K+D + +A Y + PT F++G P D + G A +I Sbjct: 114 IQVVKIDTEKYPSIANKYKIEALPTFILFKDGEPCDRFEGALTAKQLI 161 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 33.9 bits (74), Expect = 0.12 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +2 Query: 170 ILVEFYAPWCGHCKSLAPEYAKAATK 247 ++++ Y WCG CK +AP+Y + + K Sbjct: 100 VVLDMYTQWCGPCKVIAPKYKELSEK 125 >At3g19780.1 68416.m02504 expressed protein Length = 1014 Score = 33.1 bits (72), Expect = 0.20 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +2 Query: 122 VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEKNLL 268 +L++ NF + I ++L+ PWCG +SL E + + E LL Sbjct: 29 ILTEQNFSSQIRLHPHVLLFVTTPWCGESRSLKYEITQMVQRREEFGLL 77 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 33.1 bits (72), Expect = 0.20 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +2 Query: 170 ILVEFYAPWCGHCKSLAPEYAKAATK 247 ++++ Y WCG CK +AP+Y + K Sbjct: 90 VVLDMYTQWCGPCKVIAPKYKALSEK 115 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 32.7 bits (71), Expect = 0.27 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +1 Query: 280 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 432 K+D + Q +A+ + V PT F + G+ ID G D+I L K G Sbjct: 63 KIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKLMKHGG 113 Score = 31.5 bits (68), Expect = 0.62 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +2 Query: 170 ILVEFYAPWCGHCKSLAPEYAKAATK 247 I+++F A WC C+ +AP +A+ A K Sbjct: 30 IVIDFTASWCPPCRFIAPVFAEMAKK 55 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 32.3 bits (70), Expect = 0.36 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 170 ILVEFYAPWCGHCKSLAP 223 +LV+FYA WCG C+ + P Sbjct: 79 VLVDFYATWCGPCQLMVP 96 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +1 Query: 268 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDII 408 I + K+D + LA Y + PT F++G D + G A+ ++ Sbjct: 109 IAVVKIDTEKYPSLANKYQIEALPTFILFKDGKLWDRFEGALPANQLV 156 >At4g32580.1 68417.m04638 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 160 Score = 31.9 bits (69), Expect = 0.47 Identities = 21/87 (24%), Positives = 40/87 (45%), Gaps = 3/87 (3%) Frame = +1 Query: 280 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG---PPAVEV 450 +V+A + +++E+Y V P FF++G +D G + + + K G P ++ + Sbjct: 57 RVEAEEHPEISEAYSVALVPYFVFFKDGKTVDTLEGADPSSLANKVGKVAGSITPASLGL 116 Query: 451 TSAEQAKELIDANTVIVFGSFRTRAQP 531 + E + N S + RAQP Sbjct: 117 AAGPTILETVKKNAK---ASGQDRAQP 140 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 31.9 bits (69), Expect = 0.47 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 256 EESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID 375 + S + KVD + D+A S+ + PT F R+G +D Sbjct: 320 QHSRVVFLKVDIDKANDVAASWNISSVPTFCFIRDGKEVD 359 Score = 31.1 bits (67), Expect = 0.82 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +2 Query: 170 ILVEFYAPWCGHCKSLAPEYAKAATK 247 +++ F A WCG C+ ++P Y+ AT+ Sbjct: 295 LILYFTATWCGPCRYMSPLYSNLATQ 320 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 31.1 bits (67), Expect = 0.82 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 143 ETVITTTEYILVEFYAPWCGHCK 211 ++V+ + +LVEFY WCG C+ Sbjct: 78 DSVLKSETPVLVEFYTSWCGPCR 100 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 30.7 bits (66), Expect = 1.1 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 170 ILVEFYAPWCGHCKSLAPEYAKAATK 247 I+++F A WC C+ +AP +A A K Sbjct: 30 IVIDFTATWCPPCRFIAPVFADLAKK 55 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 280 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 423 KVD + +AE + V+ PT F + G + G ++II+ L+K Sbjct: 63 KVDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEK 110 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 30.7 bits (66), Expect = 1.1 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +2 Query: 137 NFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 247 +F + + + ++V+F A WCG C+ + P A K Sbjct: 39 HFNEIKESNKLLVVDFSASWCGPCRMIEPAIHAMADK 75 >At4g08930.1 68417.m01470 thioredoxin-related contains weak similarity to Swiss-Prot:Q39239 thioredoxin H-type 4 (TRX-H-4). [Mouse-ear cress] Length = 295 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 319 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 432 YGV G+PT+ + + Y G R D ++++ TG Sbjct: 124 YGVHGFPTIILMNSTMLVVYRGSRTLDSLVAFYTDVTG 161 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 170 ILVEFYAPWCGHCKSLAPEYAKAATK 247 ++V+FYA WCG C +A E A + Sbjct: 97 LIVDFYATWCGPCILMAQELEMLAVE 122 Score = 28.3 bits (60), Expect = 5.8 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = +1 Query: 259 ESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSP 369 ES + KVD E + A VRG PTL FF + P Sbjct: 124 ESNAIIVKVDTDDEYEFARDMQVRGLPTL-FFISPDP 159 >At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466, gb|N96726, gb|AA042340, and emb|Z18150 Length = 275 Score = 30.3 bits (65), Expect = 1.4 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 170 ILVEFYAPWCGHCKSLAPEYAKAA 241 ++V+F++P CG CK+L P+ + A Sbjct: 120 VVVDFFSPGCGGCKALHPKICQFA 143 >At1g07960.3 68414.m00867 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 30.3 bits (65), Expect = 1.4 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 1/74 (1%) Frame = +1 Query: 259 ESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGP 435 + I++ +VD + + + YPT F NG + Y G R + + +++ ++T Sbjct: 75 DDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEET-E 133 Query: 436 PAVEVTSAEQAKEL 477 A E E KEL Sbjct: 134 KAAEKAQLED-KEL 146 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +2 Query: 116 VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 217 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At1g07960.2 68414.m00866 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 30.3 bits (65), Expect = 1.4 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 1/74 (1%) Frame = +1 Query: 259 ESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGP 435 + I++ +VD + + + YPT F NG + Y G R + + +++ ++T Sbjct: 75 DDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEET-E 133 Query: 436 PAVEVTSAEQAKEL 477 A E E KEL Sbjct: 134 KAAEKAQLED-KEL 146 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +2 Query: 116 VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 217 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At1g07960.1 68414.m00865 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 30.3 bits (65), Expect = 1.4 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 1/74 (1%) Frame = +1 Query: 259 ESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGP 435 + I++ +VD + + + YPT F NG + Y G R + + +++ ++T Sbjct: 75 DDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEET-E 133 Query: 436 PAVEVTSAEQAKEL 477 A E E KEL Sbjct: 134 KAAEKAQLED-KEL 146 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +2 Query: 116 VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 217 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At1g04700.1 68414.m00467 protein kinase family protein low similarity to EDR1 [Arabidopsis thaliana] GI:11127925; contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 1042 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/40 (35%), Positives = 25/40 (62%) Frame = +3 Query: 600 KVIKELEAEDEDVVLFKNFEEKRVKYEDEEITEDLLNAWV 719 +V+ + ED D + F N E KR K + E+T+++ N+W+ Sbjct: 459 RVVATSKWEDSDDIYFNNPEGKRCK--ELELTKEVPNSWI 496 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 29.5 bits (63), Expect = 2.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 170 ILVEFYAPWCGHCKSLAPEYAKAATK 247 ++ F A WCG CK +AP + + + K Sbjct: 48 VVANFSATWCGPCKIVAPFFIELSEK 73 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 29.1 bits (62), Expect = 3.3 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 161 TEYILVEFYAPWCGHCKSLAP 223 T +++V F A WCG C+ + P Sbjct: 227 TPHVMVMFTARWCGPCRDMIP 247 >At1g60420.1 68414.m06802 DC1 domain-containing protein contains Pfam domain PF03107: DC1 domain Length = 578 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +2 Query: 170 ILVEFYAPWCGHCKSLAPEYAKAATKLAEKN 262 IL+ F A WC C++ P+ + ++ E+N Sbjct: 366 ILMYFSAHWCPPCRAFTPKLVEVYKQIKERN 396 >At1g49900.1 68414.m05596 zinc finger (C2H2 type) family protein contains Pfam profile: PF00096 zinc finger, C2H2 type Length = 917 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 591 SDEKVIKELEAEDEDVVLFKNFEEKRVKYEDEE 689 SD ++ + E+ED VLF+ + + R+K D E Sbjct: 520 SDHGNVESIRLEEEDAVLFEPWLKSRLKSRDRE 552 >At1g11530.1 68414.m01324 thioredoxin family protein similar to thioredoxin H-type from Arabidopsis thaliana SP|P29448, Nicotiana tabacum SP|Q07090; contains Pfam profile: PF00085 Thioredoxin Length = 118 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +1 Query: 283 VDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDI 405 VD + +++A V+ PT F ++G+ +D G D+I Sbjct: 61 VDVDEVKEVASQLEVKAMPTFLFLKDGNAMDKLVGANPDEI 101 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -1 Query: 482 SISSLACSAEVTSTAGGPVFFFSQLMMSSA*RPP 381 S ++ AC +S+ GGP +++ S + RPP Sbjct: 60 SPTTTACPPPPSSSGGGPYYYYPPASQSGSYRPP 93 >At4g05490.1 68417.m00830 F-box family protein (FBL22) contains similarity to N7 protein GI:3273101 from [Medicago truncatula] Length = 307 Score = 27.9 bits (59), Expect = 7.7 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +3 Query: 492 CYCIWFFSD---QSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDED 635 C+ I F D Q R K F V+DD + I SD I++ + E+E+ Sbjct: 238 CFNINLFGDLERQCLERIKDFRCPNDVLDDYNYVIFSDNGSIEDEKGEEEE 288 >At2g27350.3 68415.m03293 OTU-like cysteine protease family protein contains Pfam profile PF02338: OTU-like cysteine protease Length = 506 Score = 27.9 bits (59), Expect = 7.7 Identities = 24/107 (22%), Positives = 45/107 (42%), Gaps = 3/107 (2%) Frame = +1 Query: 151 NYNHGVHFS*ILCSMVRPLQIS-GTGIRQGSNKAG*EESPIKLAKVDATQEQDLAESYGV 327 +Y+HG H++ S+V P +++ G G+ S + A + A QE + + Sbjct: 326 SYHHGNHYN----SLVDPHRLTVGAGLGFSSLSGRHVDKEQVKAAIKAQQEHQIDNALLA 381 Query: 328 RG--YPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAE 462 G Y L+ +A+ ++ W K + GP ++AE Sbjct: 382 EGRFYSDLELTEKEIERSVMEASRAEYLMEWSKPRIGPKESSTSNAE 428 >At2g27350.2 68415.m03292 OTU-like cysteine protease family protein contains Pfam profile PF02338: OTU-like cysteine protease Length = 505 Score = 27.9 bits (59), Expect = 7.7 Identities = 24/107 (22%), Positives = 45/107 (42%), Gaps = 3/107 (2%) Frame = +1 Query: 151 NYNHGVHFS*ILCSMVRPLQIS-GTGIRQGSNKAG*EESPIKLAKVDATQEQDLAESYGV 327 +Y+HG H++ S+V P +++ G G+ S + A + A QE + + Sbjct: 326 SYHHGNHYN----SLVDPHRLTVGAGLGFSSLSGRHVDKEQVKAAIKAQQEHQIDNALLA 381 Query: 328 RG--YPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAE 462 G Y L+ +A+ ++ W K + GP ++AE Sbjct: 382 EGRFYSDLELTEKEIERSVMEASRAEYLMEWSKPRIGPKESSTSNAE 428 >At2g27350.1 68415.m03291 OTU-like cysteine protease family protein contains Pfam profile PF02338: OTU-like cysteine protease Length = 505 Score = 27.9 bits (59), Expect = 7.7 Identities = 24/107 (22%), Positives = 45/107 (42%), Gaps = 3/107 (2%) Frame = +1 Query: 151 NYNHGVHFS*ILCSMVRPLQIS-GTGIRQGSNKAG*EESPIKLAKVDATQEQDLAESYGV 327 +Y+HG H++ S+V P +++ G G+ S + A + A QE + + Sbjct: 326 SYHHGNHYN----SLVDPHRLTVGAGLGFSSLSGRHVDKEQVKAAIKAQQEHQIDNALLA 381 Query: 328 RG--YPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAE 462 G Y L+ +A+ ++ W K + GP ++AE Sbjct: 382 EGRFYSDLELTEKEIERSVMEASRAEYLMEWSKPRIGPKESSTSNAE 428 >At1g26680.1 68414.m03250 transcriptional factor B3 family protein low similarity to reproductive meristem gene 1 from [Brassica oleracea var. botrytis] GI:3170424, [Arabidopsis thaliana] GI:13604227; contains Pfam profile PF02362: B3 DNA binding domain Length = 920 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -1 Query: 266 GDSSQPALLLPWRIPVPEICSGRTMEHRIQLKCT 165 GDS + L+ W+ PV +C ++ H+ L+C+ Sbjct: 340 GDSFKFKLVGTWKKPVLSLCPTQSNNHKTPLECS 373 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,917,487 Number of Sequences: 28952 Number of extensions: 296238 Number of successful extensions: 1080 Number of sequences better than 10.0: 67 Number of HSP's better than 10.0 without gapping: 974 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1068 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1672953192 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -