BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1185 (760 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19C2.10 |||BAR adaptor protein|Schizosaccharomyces pombe|chr... 28 1.3 SPBC1709.15c |cft2||cleavage factor two Cft2/polyadenylation fac... 27 2.2 SPBC649.05 |cut12|stf1|spindle pole body protein Cut12 |Schizosa... 26 5.1 >SPBC19C2.10 |||BAR adaptor protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 501 Score = 28.3 bits (60), Expect = 1.3 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +3 Query: 384 VGDNDRSSSXAATNSSQPT*PPL--HRKPQHSPTQNGPV 494 V D S +A + + P+ PP+ H KP+ S TQ+ PV Sbjct: 319 VSDAQNSLGQSAVDLTTPSSPPIPRHTKPKLSTTQSTPV 357 >SPBC1709.15c |cft2||cleavage factor two Cft2/polyadenylation factor CPSF-73 |Schizosaccharomyces pombe|chr 2|||Manual Length = 797 Score = 27.5 bits (58), Expect = 2.2 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +2 Query: 134 YIDPGDDDLEVNLPDYGEDPADLQLL--QDVGKRSSLIYVF 250 YIDPG DD + P+ E P DL LL D+ L+Y + Sbjct: 26 YIDPGSDD-SLKHPEVPEQP-DLILLSHSDLAHIGGLVYAY 64 >SPBC649.05 |cut12|stf1|spindle pole body protein Cut12 |Schizosaccharomyces pombe|chr 2|||Manual Length = 548 Score = 26.2 bits (55), Expect = 5.1 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -2 Query: 702 SINQSKRELTKRKQQLNRISFSKFLYIYKCSKNISKLKYKS 580 +IN+S + TK Q+L SK Y + ISK K+ S Sbjct: 156 NINESYKNETKSNQRLGEDVPSKKKYPHSMDAEISKFKWDS 196 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,660,925 Number of Sequences: 5004 Number of extensions: 49270 Number of successful extensions: 130 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 130 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 363302114 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -