BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1185 (760 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U67948-3|AAM51499.1| 1077|Caenorhabditis elegans Hypothetical pr... 28 8.3 U61946-10|AAC24388.1| 1827|Caenorhabditis elegans Hypothetical p... 28 8.3 >U67948-3|AAM51499.1| 1077|Caenorhabditis elegans Hypothetical protein M02E1.1a protein. Length = 1077 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = +2 Query: 446 AAPPEATTFANTKRTRCVLIFRSIPSHSP*LFKQFNLVKFK 568 + P +F+N C + S P SP QFN + FK Sbjct: 1037 STPAPFPSFSNNPMPACPSMIPSFPVFSPDQLHQFNAINFK 1077 >U61946-10|AAC24388.1| 1827|Caenorhabditis elegans Hypothetical protein F47C12.1 protein. Length = 1827 Score = 27.9 bits (59), Expect = 8.3 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +1 Query: 187 GSSRFAVVT-GCRETIVADLRFQAACVRRGGNCDHRPGDCCHSSSCRC 327 GS V T GC+ T AD+ C++ G+CDH + S C C Sbjct: 608 GSPCLEVETLGCQRTSCADIN---ECLKDNGHCDHLCINTQGSYKCDC 652 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,214,522 Number of Sequences: 27780 Number of extensions: 299371 Number of successful extensions: 940 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 869 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 940 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1809061256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -