BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1184 (396 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g37630.1 68417.m05323 cyclin family protein similar to SP|P42... 27 6.0 At4g24450.1 68417.m03505 starch excess protein-related similar t... 26 7.9 >At4g37630.1 68417.m05323 cyclin family protein similar to SP|P42753 Cyclin delta-3 {Arabidopsis thaliana}; contains Pfam profile PF00134: Cyclin, N-terminal domain Length = 323 Score = 26.6 bits (56), Expect = 6.0 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 4/75 (5%) Frame = -3 Query: 379 YFSHYL--FHKLRHSFHIKNVILRNILYLLFINTII*--ELSRHNIFAILVLLALSSKDR 212 YF+++L + HS V+LR+ LL + I E + + A+ LLA SS Sbjct: 180 YFNYFLAKISQDNHSVSKDLVLLRSSDSLLALTKEISFTEYRQFVVAAVTTLLASSSTSS 239 Query: 211 DIKLNVLKT*NKFTS 167 DI+L + NKF S Sbjct: 240 DIRLTREEIANKFGS 254 >At4g24450.1 68417.m03505 starch excess protein-related similar to SEX1 [Arabidopsis thaliana] GI:12044358 Length = 1284 Score = 26.2 bits (55), Expect = 7.9 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +3 Query: 219 FDDNANKTRIANILCRDNSYIIVLINRRYNIFLKITFLMW 338 F A +T+ ++ R++SY + IN + F+ I F++W Sbjct: 309 FVHGACQTQFTDMSSREHSYQFIDINLKRGGFVGIQFVIW 348 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,493,631 Number of Sequences: 28952 Number of extensions: 107266 Number of successful extensions: 191 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 189 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 191 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 565902384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -