BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1180 (739 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 25 0.84 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 23 3.4 AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 22 4.5 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 5.9 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 5.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 5.9 AF264718-1|AAF75271.1| 125|Tribolium castaneum putative cytochr... 21 7.9 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 24.6 bits (51), Expect = 0.84 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +3 Query: 243 IEVSTESHCGKYKRIKKMKFFVK 311 +E S+E +C +KK+KF +K Sbjct: 64 LENSSEENCVSMSNLKKLKFLLK 86 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +3 Query: 33 LERKRRKNKKISPCVFSWVIR 95 +E + + K+ +P +FSW IR Sbjct: 117 VENRIEQYKRENPSIFSWEIR 137 >AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor candidate 28 protein. Length = 248 Score = 22.2 bits (45), Expect = 4.5 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = -2 Query: 291 FLCVYISHNDFRYLLQ**KSLWCYLRFVYVKILLQQNQLPVSNKQTFI 148 F VY +N F + L+C L+F ++L + + VSN F+ Sbjct: 66 FRFVYAVYNIFGAFVM---GLFCILKFALDGLMLDKTGICVSNVFDFV 110 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.8 bits (44), Expect = 5.9 Identities = 11/36 (30%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -3 Query: 374 ENITSKLLSKTF-QNISHSPNSFDKKLHFFYAFIFP 270 EN S+ F + + S F + +F YAF+ P Sbjct: 26 ENFVSETSYLPFIRALGKSKKEFKTRTYFIYAFVAP 61 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 5.9 Identities = 11/36 (30%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -3 Query: 374 ENITSKLLSKTF-QNISHSPNSFDKKLHFFYAFIFP 270 EN S+ F + + S F + +F YAF+ P Sbjct: 259 ENFVSETSYLPFIRALGKSKKEFKTRTYFIYAFVAP 294 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 5.9 Identities = 11/36 (30%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -3 Query: 374 ENITSKLLSKTF-QNISHSPNSFDKKLHFFYAFIFP 270 EN S+ F + + S F + +F YAF+ P Sbjct: 259 ENFVSETSYLPFIRALGKSKKEFKTRTYFIYAFVAP 294 >AF264718-1|AAF75271.1| 125|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q6 protein. Length = 125 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = -1 Query: 667 LQTETHYCFTEQIGRAMVPTHADSQEV 587 +QT+ +G+ +PT+ D QE+ Sbjct: 18 IQTKVREEILSVVGKEKIPTYNDLQEL 44 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,475 Number of Sequences: 336 Number of extensions: 4034 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19779950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -