BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1180 (739 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37120| Best HMM Match : EB (HMM E-Value=4.2) 29 3.9 SB_58259| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_57972| Best HMM Match : Phage_integrase (HMM E-Value=0.85) 28 6.9 SB_13852| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 >SB_37120| Best HMM Match : EB (HMM E-Value=4.2) Length = 376 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = -1 Query: 703 VLRSHSYNGCPTLQTETHYCFTEQIGRAMVPTHADSQEVLPPVNTHT 563 + ++H+Y G PT +T+ H + T+ +S V+T+T Sbjct: 27 ITKAHTYTGSPTSKTKAHTYTESPTSKTKAHTYTESPTSKTVVHTYT 73 >SB_58259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 28.7 bits (61), Expect = 5.2 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = -1 Query: 688 SYNGCPTLQTETHYCFTEQIGRAMVPTHADSQEVLPPVNTHT 563 S GCPT+ + T + PT ++ +LP N+HT Sbjct: 127 SPQGCPTVPSTTQTPLPPKTNPTTEPTESNEVPLLPTENSHT 168 >SB_57972| Best HMM Match : Phage_integrase (HMM E-Value=0.85) Length = 264 Score = 28.3 bits (60), Expect = 6.9 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = -1 Query: 166 QQTNIHRDKLKLTNEVNDLPRAPGLITHENTQGEIFLFFLRFLSSKTL 23 + +++RDKL L++EV L P I+H + LFF R + TL Sbjct: 88 ENVSLNRDKLLLSDEVTSLRARPFEISHSYEED---LFFSREIEVTTL 132 >SB_13852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 846 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -1 Query: 211 RVCKNTSAAKSTPSVQQTNIHRDKLKLTNEVNDL 110 + CKN K+ + D LKLT +V DL Sbjct: 393 KTCKNIEELKNKMETRYRKCKEDNLKLTGDVKDL 426 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,173,472 Number of Sequences: 59808 Number of extensions: 463068 Number of successful extensions: 1070 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 920 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1069 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1986074805 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -