BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1180 (739 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14... 25 1.8 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 9.8 >AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14D2 protein. Length = 372 Score = 25.4 bits (53), Expect = 1.8 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = -1 Query: 739 PIDIYNVHLEI*VLRSHSYNGCPTLQTETHYCFTEQIGRAMVPTHADSQEV 587 PI+ Y VH + YN LQ FT+ I +PT +S+ V Sbjct: 200 PINAYVVHPDYYKQNGADYNDIALLQLSETVEFTDFIRPICLPTSEESRTV 250 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.0 bits (47), Expect = 9.8 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -1 Query: 652 HYCFTEQIGRAMVPTHADSQEVLP-PVNTHT 563 H F +IG ++V DS E+LP P N T Sbjct: 939 HIEFHAEIGMSLVLKVGDSSEMLPAPANFPT 969 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 775,079 Number of Sequences: 2352 Number of extensions: 14997 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -