BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1179 (809 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3H7.06c |pof9||F-box protein Paf9|Schizosaccharomyces pombe|... 33 0.063 SPBC17D11.02c |||synoviolin homolog|Schizosaccharomyces pombe|ch... 26 5.5 >SPBC3H7.06c |pof9||F-box protein Paf9|Schizosaccharomyces pombe|chr 2|||Manual Length = 467 Score = 32.7 bits (71), Expect = 0.063 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -1 Query: 809 HTIFPWNVNNKLCGCRARGPLHTQHYT 729 H+I+ W V + CGC G LH Q T Sbjct: 356 HSIWSWGVELRYCGCLGLGSLHLQEQT 382 >SPBC17D11.02c |||synoviolin homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 677 Score = 26.2 bits (55), Expect = 5.5 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Frame = +3 Query: 690 KFLLYYLICLVMF--SVVLRVEWSAGATSAELIVN 788 KF+LY L LV+F SV+L + SA SA ++++ Sbjct: 2 KFILYVLASLVLFGLSVLLSLYSSANVYSATVMIS 36 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,730,629 Number of Sequences: 5004 Number of extensions: 48187 Number of successful extensions: 58 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 394431430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -