BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1177 (407 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 25 0.44 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 0.44 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 24 0.76 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 23 1.8 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 21 4.1 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 21 7.1 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 7.1 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 24.6 bits (51), Expect = 0.44 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 41 WAPVHSASLLPVYCQ 85 WAP H+ LL VY Q Sbjct: 298 WAPFHAQRLLAVYAQ 312 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.6 bits (51), Expect = 0.44 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 Query: 75 TGSSEALCTGAHVRDHPLFTIICLP 1 T SSE+L AH R +P F+ C P Sbjct: 57 TRSSESLTAQAHHRLYPAFSSSCDP 81 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 23.8 bits (49), Expect = 0.76 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 41 WAPVHSASLLPVYCQ 85 WAP H+ LL VY Q Sbjct: 283 WAPFHTQRLLYVYAQ 297 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 22.6 bits (46), Expect = 1.8 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 312 TRESIDFVVNCLHH 353 T ES+D + N LHH Sbjct: 459 TEESVDALCNTLHH 472 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.4 bits (43), Expect = 4.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 Query: 174 HPGFGTRWQRARKFF 218 HPGF + RAR+ F Sbjct: 199 HPGFADKEYRARRKF 213 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 20.6 bits (41), Expect = 7.1 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 41 WAPVHSASLLPVY 79 WAP H LL VY Sbjct: 273 WAPFHVQRLLYVY 285 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 20.6 bits (41), Expect = 7.1 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -1 Query: 227 SSKEEFSGSLPASAKSRVISPSLISDPWIFKS 132 S+ E F G+ P + + L P IFKS Sbjct: 115 SADEGFDGTYPTNVVVKNNGTCLYVPPGIFKS 146 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,984 Number of Sequences: 438 Number of extensions: 2456 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10256061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -