BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1174 (696 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6C3.08 |||gankyrin|Schizosaccharomyces pombe|chr 1|||Manual 28 1.1 SPBC23G7.04c |nif1||SEL1 repear protein Nif1|Schizosaccharomyces... 28 1.5 SPCC613.12c |raf1|dos1, cmc1, clr8|Rik1-associated factor Raf1|S... 27 2.6 SPBC1703.07 |||ATP citrate synthase subunit 1 |Schizosaccharomyc... 27 3.4 SPBC776.13 |cnd1||condensin subunit Cnd1|Schizosaccharomyces pom... 26 5.9 SPAC22F3.11c |snu23||U4/U6 x U5 tri-snRNP complex subunit Snu23|... 25 7.8 SPAC4H3.11c |ppc89|mug127|spindle pole body protein Ppc89|Schizo... 25 7.8 >SPAC6C3.08 |||gankyrin|Schizosaccharomyces pombe|chr 1|||Manual Length = 234 Score = 28.3 bits (60), Expect = 1.1 Identities = 14/43 (32%), Positives = 18/43 (41%) Frame = -3 Query: 202 HPSYSV*RRLVSLCTPRTDRRDQTPLSYCPSRIETSEVSQCCR 74 HP V T R D + T L CP RI +E + C+ Sbjct: 186 HPDVGVELVRAGADTLRKDSENHTALEVCPDRIVCNEFLEACK 228 >SPBC23G7.04c |nif1||SEL1 repear protein Nif1|Schizosaccharomyces pombe|chr 2|||Manual Length = 681 Score = 27.9 bits (59), Expect = 1.5 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -2 Query: 284 TTYLQGSAGVFYGLQLGSNKTCAVAVYSSFLFCLKEAS 171 ++Y +A YGL L C+ + SFLF LK A+ Sbjct: 472 SSYEDYTATFIYGLYLRHGLACSPKTHVSFLFLLKTAT 509 >SPCC613.12c |raf1|dos1, cmc1, clr8|Rik1-associated factor Raf1|Schizosaccharomyces pombe|chr 3|||Manual Length = 638 Score = 27.1 bits (57), Expect = 2.6 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 499 RVDFENTNKTTFSENKS*LDRFIAPEIPC 585 +VDF+ N+ F E D F E+PC Sbjct: 26 KVDFDTNNEEFFEEEFEIYDPFYRAELPC 54 >SPBC1703.07 |||ATP citrate synthase subunit 1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 615 Score = 26.6 bits (56), Expect = 3.4 Identities = 9/26 (34%), Positives = 19/26 (73%) Frame = -2 Query: 578 ISGAINRSSYDLFSENVVLFVFSKST 501 ++G++++ SY+LFS++ FV+ T Sbjct: 1 MAGSVDKPSYELFSKDTRAFVYGMQT 26 >SPBC776.13 |cnd1||condensin subunit Cnd1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1158 Score = 25.8 bits (54), Expect = 5.9 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 76 DSTGKLQKFLFSKDNMKAAFDLDGLYAECK 165 D +L+K++ ++N DLD +YAEC+ Sbjct: 4 DLLSRLKKYIHDEENS----DLDSIYAECE 29 >SPAC22F3.11c |snu23||U4/U6 x U5 tri-snRNP complex subunit Snu23|Schizosaccharomyces pombe|chr 1|||Manual Length = 151 Score = 25.4 bits (53), Expect = 7.8 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = +1 Query: 460 KKNSIIIRQ*MSGRVDFE-NTNKTT 531 KKN ++I + R+DFE + NKTT Sbjct: 14 KKNEVVITGGRTQRIDFEKDVNKTT 38 >SPAC4H3.11c |ppc89|mug127|spindle pole body protein Ppc89|Schizosaccharomyces pombe|chr 1|||Manual Length = 783 Score = 25.4 bits (53), Expect = 7.8 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 558 SIYRPRNPLYTKFYENRWNRFR 623 S+ +PR F E WNRFR Sbjct: 82 SVEKPRGRNMNAFEETSWNRFR 103 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,574,272 Number of Sequences: 5004 Number of extensions: 49731 Number of successful extensions: 118 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 118 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 321151040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -