BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1174 (696 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U21324-7|AAA62566.1| 265|Caenorhabditis elegans Hypothetical pr... 54 1e-07 AC024757-1|AAF59450.3| 490|Caenorhabditis elegans Hypothetical ... 29 2.4 >U21324-7|AAA62566.1| 265|Caenorhabditis elegans Hypothetical protein C35D10.10 protein. Length = 265 Score = 54.0 bits (124), Expect = 1e-07 Identities = 28/66 (42%), Positives = 40/66 (60%) Frame = +1 Query: 4 PTSRQLPTVMVMSEGREKMRRPXPDSTGKLQKFLFSKDNMKAAFDLDGLYAECKEKLASF 183 P SRQLPT+ V + +E RRP + + + F+FS++N AFDL LY E KEK + Sbjct: 201 PMSRQLPTICVFKDAKEIARRPLVNDSRRAVPFVFSEENCVLAFDLLNLYNEQKEKKGA- 259 Query: 184 RQNKKD 201 + K+D Sbjct: 260 KAKKED 265 >AC024757-1|AAF59450.3| 490|Caenorhabditis elegans Hypothetical protein Y37E11AL.5 protein. Length = 490 Score = 29.5 bits (63), Expect = 2.4 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +2 Query: 545 NRS*IDLSPPKSPVYQIL*KSLEPFPRFRLYMYI 646 N + +L PKSPV I SLEPF R+ +Y+ Sbjct: 76 NATLFELLEPKSPVLSIKPDSLEPFGTTRMSIYM 109 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,223,179 Number of Sequences: 27780 Number of extensions: 278933 Number of successful extensions: 641 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 625 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 641 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1602927856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -