BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1172X (502 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC23E6.09 |ssn6||transcriptional corepressor Ssn6|Schizosaccha... 27 1.2 SPCC4B3.13 |||MatE family transporter|Schizosaccharomyces pombe|... 25 4.8 SPCC895.03c |||SUA5/yciO/yrdC family|Schizosaccharomyces pombe|c... 25 8.4 >SPBC23E6.09 |ssn6||transcriptional corepressor Ssn6|Schizosaccharomyces pombe|chr 2|||Manual Length = 1102 Score = 27.5 bits (58), Expect = 1.2 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +1 Query: 337 PDLRRAWPVPQQRQDTEMQMYMPAKTMPEVPIVYSSQQQT 456 P L+R P+ Q + Q+ +P + P +P+ QQQ+ Sbjct: 134 PQLQRMMPILSSNQPIQ-QLPLPNQASPYIPVPLQQQQQS 172 >SPCC4B3.13 |||MatE family transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 539 Score = 25.4 bits (53), Expect = 4.8 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = +1 Query: 358 PVPQQRQDTEMQMYMPAKTMPEVPIVYSSQQQT 456 P+PQ+R T ++ P P + Y + ++T Sbjct: 40 PIPQERPTTSLRKPTPRVQRPATDVSYGALEET 72 >SPCC895.03c |||SUA5/yciO/yrdC family|Schizosaccharomyces pombe|chr 3|||Manual Length = 408 Score = 24.6 bits (51), Expect = 8.4 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = -2 Query: 411 LSRHIHLHLR-VLSLLRNGPGAAQVGLGPREPRVSCPPPTLLHPSHTGL 268 L++H++ L+ + L+ +G GA VG+ C PP +L P L Sbjct: 204 LAKHVYNDLQGKIPLILDG-GACGVGVESTVVNGLCDPPVILRPGGISL 251 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,909,216 Number of Sequences: 5004 Number of extensions: 35767 Number of successful extensions: 95 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 95 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 198176188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -