BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1172X (502 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 4.1 AB264332-1|BAF44087.1| 58|Apis mellifera ecdysone-induced prot... 21 5.5 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 5.5 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.8 bits (44), Expect = 4.1 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = -2 Query: 366 RNGPGAAQVGLGPREPRVSCPPPTLLHPSHTGLRSPR 256 R+GP + + PREP T L H + PR Sbjct: 127 RDGPPSVSLSSPPREPGTPRINFTKLKRHHPRYKRPR 163 >AB264332-1|BAF44087.1| 58|Apis mellifera ecdysone-induced protein 75 protein. Length = 58 Score = 21.4 bits (43), Expect = 5.5 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 200 QEPSGDAQFPAFEP 241 Q+PSGD P+ EP Sbjct: 16 QQPSGDILSPSSEP 29 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 5.5 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 200 QEPSGDAQFPAFEP 241 Q+PSGD P+ EP Sbjct: 16 QQPSGDILSPSSEP 29 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,872 Number of Sequences: 438 Number of extensions: 3172 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13741392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -