BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1171 (498 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC048251-1|AAH48251.1| 322|Homo sapiens ZDHHC12 protein protein. 30 3.9 AL441992-6|CAI15406.1| 210|Homo sapiens zinc finger, DHHC-type ... 30 3.9 BC034604-1|AAH34604.1| 753|Homo sapiens striatin, calmodulin bi... 30 5.1 BC004910-1|AAH04910.2| 349|Homo sapiens STRN4 protein protein. 30 5.1 AF212940-1|AAF29527.1| 753|Homo sapiens zinedin protein. 30 5.1 AB209003-1|BAD92240.1| 755|Homo sapiens Zinedin variant protein. 30 5.1 Y09723-1|CAA70889.1| 803|Homo sapiens Miz-1 protein protein. 29 6.8 BC126163-1|AAI26164.1| 803|Homo sapiens zinc finger and BTB dom... 29 6.8 AL034555-3|CAB85445.1| 803|Homo sapiens zinc finger and BTB dom... 29 6.8 AK223618-1|BAD97338.1| 803|Homo sapiens zinc finger and BTB dom... 29 6.8 >BC048251-1|AAH48251.1| 322|Homo sapiens ZDHHC12 protein protein. Length = 322 Score = 30.3 bits (65), Expect = 3.9 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +3 Query: 141 TPLRPKPA*PNPARICSLWSPESRE 215 TP P P P PA +CS SPE R+ Sbjct: 68 TPTPPTPVLPGPASLCSPASPELRQ 92 >AL441992-6|CAI15406.1| 210|Homo sapiens zinc finger, DHHC-type containing 12 protein. Length = 210 Score = 30.3 bits (65), Expect = 3.9 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +3 Query: 141 TPLRPKPA*PNPARICSLWSPESRE 215 TP P P P PA +CS SPE R+ Sbjct: 68 TPTPPTPVLPGPASLCSPASPELRQ 92 >BC034604-1|AAH34604.1| 753|Homo sapiens striatin, calmodulin binding protein 4 protein. Length = 753 Score = 29.9 bits (64), Expect = 5.1 Identities = 19/44 (43%), Positives = 23/44 (52%) Frame = +2 Query: 170 ESGKDMLTVEPRESGGSKQCDFTSRVSH*NARRDVEAHLDRGDR 301 E G +LT+E R S G Q + VSH N + AH DRG R Sbjct: 621 EVGSALLTLESRGSSGPTQINQV--VSHPNQPLTITAHDDRGIR 662 >BC004910-1|AAH04910.2| 349|Homo sapiens STRN4 protein protein. Length = 349 Score = 29.9 bits (64), Expect = 5.1 Identities = 19/44 (43%), Positives = 23/44 (52%) Frame = +2 Query: 170 ESGKDMLTVEPRESGGSKQCDFTSRVSH*NARRDVEAHLDRGDR 301 E G +LT+E R S G Q + VSH N + AH DRG R Sbjct: 217 EVGSALLTLESRGSSGPTQINQV--VSHPNQPLTITAHDDRGIR 258 >AF212940-1|AAF29527.1| 753|Homo sapiens zinedin protein. Length = 753 Score = 29.9 bits (64), Expect = 5.1 Identities = 19/44 (43%), Positives = 23/44 (52%) Frame = +2 Query: 170 ESGKDMLTVEPRESGGSKQCDFTSRVSH*NARRDVEAHLDRGDR 301 E G +LT+E R S G Q + VSH N + AH DRG R Sbjct: 621 EVGSALLTLESRGSSGPTQINQV--VSHPNQPLTITAHDDRGIR 662 >AB209003-1|BAD92240.1| 755|Homo sapiens Zinedin variant protein. Length = 755 Score = 29.9 bits (64), Expect = 5.1 Identities = 19/44 (43%), Positives = 23/44 (52%) Frame = +2 Query: 170 ESGKDMLTVEPRESGGSKQCDFTSRVSH*NARRDVEAHLDRGDR 301 E G +LT+E R S G Q + VSH N + AH DRG R Sbjct: 623 EVGSALLTLESRGSSGPTQINQV--VSHPNQPLTITAHDDRGIR 664 >Y09723-1|CAA70889.1| 803|Homo sapiens Miz-1 protein protein. Length = 803 Score = 29.5 bits (63), Expect = 6.8 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = +2 Query: 119 PSAGLCLNASKAEASLAESGKDMLTVEPRESGGSKQ 226 P++G+ A++AEA+L+ES + + VEP G +Q Sbjct: 201 PTSGMA--AAEAEAALSESSEQEMEVEPARKGEEEQ 234 >BC126163-1|AAI26164.1| 803|Homo sapiens zinc finger and BTB domain containing 17 protein. Length = 803 Score = 29.5 bits (63), Expect = 6.8 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = +2 Query: 119 PSAGLCLNASKAEASLAESGKDMLTVEPRESGGSKQ 226 P++G+ A++AEA+L+ES + + VEP G +Q Sbjct: 201 PTSGMA--AAEAEAALSESSEQEMEVEPARKGEEEQ 234 >AL034555-3|CAB85445.1| 803|Homo sapiens zinc finger and BTB domain containing 17 protein. Length = 803 Score = 29.5 bits (63), Expect = 6.8 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = +2 Query: 119 PSAGLCLNASKAEASLAESGKDMLTVEPRESGGSKQ 226 P++G+ A++AEA+L+ES + + VEP G +Q Sbjct: 201 PTSGMA--AAEAEAALSESSEQEMEVEPARKGEEEQ 234 >AK223618-1|BAD97338.1| 803|Homo sapiens zinc finger and BTB domain containing 17 variant protein. Length = 803 Score = 29.5 bits (63), Expect = 6.8 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = +2 Query: 119 PSAGLCLNASKAEASLAESGKDMLTVEPRESGGSKQ 226 P++G+ A++AEA+L+ES + + VEP G +Q Sbjct: 201 PTSGMA--AAEAEAALSESSEQEMEVEPARKGEEEQ 234 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,841,922 Number of Sequences: 237096 Number of extensions: 1687794 Number of successful extensions: 3580 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3470 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3580 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4536472160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -