BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1171 (498 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 21 5.4 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 21 5.4 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 7.1 AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 21 7.1 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 9.4 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.4 bits (43), Expect = 5.4 Identities = 16/59 (27%), Positives = 27/59 (45%) Frame = -3 Query: 412 PRQERKSSTDYSEPRHRTELYPDFGAVMHVLRKKPIASISAIQMGFYVASRVLMRNATS 236 PR+ R+ T+Y E R++ + + D ++ L +K + VAS NA S Sbjct: 405 PREMRQRITEYFEHRYQGKFF-DEELILGELSEKLREDVINYNCRSLVASVPFFANADS 462 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.4 bits (43), Expect = 5.4 Identities = 16/59 (27%), Positives = 27/59 (45%) Frame = -3 Query: 412 PRQERKSSTDYSEPRHRTELYPDFGAVMHVLRKKPIASISAIQMGFYVASRVLMRNATS 236 PR+ R+ T+Y E R++ + + D ++ L +K + VAS NA S Sbjct: 373 PREMRQRITEYFEHRYQGKFF-DEELILGELSEKLREDVINYNCRSLVASVPFFANADS 430 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.0 bits (42), Expect = 7.1 Identities = 7/11 (63%), Positives = 11/11 (100%) Frame = -3 Query: 418 TTPRQERKSST 386 TTP++ERK++T Sbjct: 789 TTPKKERKTAT 799 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 21.0 bits (42), Expect = 7.1 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 432 ASCCESVETQPCA 470 ASCC S E C+ Sbjct: 161 ASCCNSPENNTCS 173 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 20.6 bits (41), Expect = 9.4 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -1 Query: 405 RNGSRLQTIPSPDIEL 358 RNG+ L+T+ P+I + Sbjct: 346 RNGADLETLNEPEIRV 361 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,239 Number of Sequences: 438 Number of extensions: 2908 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -