BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1168 (713 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0149 - 7182562-7182891,7182989-7183575,7185334-7185433,718... 29 3.7 01_01_0977 - 7717808-7717837,7718227-7718327,7718449-7718548,771... 28 8.5 >02_02_0149 - 7182562-7182891,7182989-7183575,7185334-7185433, 7185547-7185563,7185928-7186369,7186501-7186629 Length = 534 Score = 29.1 bits (62), Expect = 3.7 Identities = 9/31 (29%), Positives = 20/31 (64%) Frame = +3 Query: 621 EVINQSVFKLVYIYYLYFIGSLPLLIGIIYN 713 +++N K++Y+YY +G +P +G++ N Sbjct: 441 DIVNLKNLKILYLYYNNLVGQIPSGVGMLPN 471 >01_01_0977 - 7717808-7717837,7718227-7718327,7718449-7718548, 7718706-7718822,7718913-7718990,7719980-7720058, 7720184-7720249,7720373-7720441,7720890-7721188 Length = 312 Score = 27.9 bits (59), Expect = 8.5 Identities = 9/33 (27%), Positives = 21/33 (63%) Frame = +3 Query: 612 LLVEVINQSVFKLVYIYYLYFIGSLPLLIGIIY 710 ++ ++N+ ++ Y Y YF+ + LL+G++Y Sbjct: 128 VIFNILNKKIYN--YFPYPYFVSVIHLLVGVVY 158 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,535,028 Number of Sequences: 37544 Number of extensions: 59283 Number of successful extensions: 128 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 128 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1851002996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -