BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1167 (508 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16H5.08c |||ribosome biogenesis ATPase, Arb family |Schizosa... 26 2.8 SPCC645.11c |mug117||meiotically upregulated gene Mug117|Schizos... 25 6.5 SPAC24H6.06 |sld3|mug175|DNA replication pre-initiation complex ... 25 6.5 >SPBC16H5.08c |||ribosome biogenesis ATPase, Arb family |Schizosaccharomyces pombe|chr 2|||Manual Length = 618 Score = 26.2 bits (55), Expect = 2.8 Identities = 14/54 (25%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +2 Query: 320 FLSSHTKISS*QQNLQGFVSTI-SNV*IICLSESNVYFFGEFNIFSTTIKSNST 478 +L+ + KI + Q F++ + +N+ + + VY+ G F+I+ T + N T Sbjct: 262 YLAKYDKILVVTSHSQDFLNNVCTNIIDLTSKKQLVYYGGNFDIYMRTKEENET 315 >SPCC645.11c |mug117||meiotically upregulated gene Mug117|Schizosaccharomyces pombe|chr 3|||Manual Length = 186 Score = 25.0 bits (52), Expect = 6.5 Identities = 10/37 (27%), Positives = 22/37 (59%) Frame = -3 Query: 440 IRQKSKRCSHLSILFTRYLLY*QNPVNSAASCLSLYE 330 +R +++ C + + + R L+Y +A+SC ++YE Sbjct: 79 LRGENRACPNAYMKYNRSLIYHGYSSYTASSCTAIYE 115 >SPAC24H6.06 |sld3|mug175|DNA replication pre-initiation complex subunit Sld3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 668 Score = 25.0 bits (52), Expect = 6.5 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +2 Query: 80 IQPNRSIPH*C*IARTCLSRRYHDY 154 + P ++P C R C+S+ YH++ Sbjct: 26 VWPLVTVPRQCICLRWCISKEYHEF 50 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,923,169 Number of Sequences: 5004 Number of extensions: 37388 Number of successful extensions: 75 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 202220600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -