BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1167 (508 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 26 0.84 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 24 2.6 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 23 5.9 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 25.8 bits (54), Expect = 0.84 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 5/59 (8%) Frame = -1 Query: 220 FIEQI*IK-VRIITPYKIAIFSDIIMISSR*TRPSYLTLMRYGTVG----LDYVFTRKE 59 F+ Q+ I+ V + T ++A F+ + +I S LM +G LDY+FT++E Sbjct: 974 FLRQVPIRRVHLFTMIQLACFAVLWLIKSFSITSILFPLMLVVMIGVRKSLDYIFTKRE 1032 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 24.2 bits (50), Expect = 2.6 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +3 Query: 21 LCEMLPRERPEARSFLVNT*SNPTVPYLISV 113 +CE+LPR +P S ++ +PT ++ +V Sbjct: 447 VCELLPRLQPRYHSISSSSKLHPTTVHVTAV 477 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.0 bits (47), Expect = 5.9 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = -1 Query: 406 AYYSHVTYCTNKTL*ILLLAAYLCMR*KKSPRNIKR 299 ++ SHV YCT K L L MR P+ KR Sbjct: 763 SWKSHVEYCTTKALRTAKALGCL-MRNHSGPKCAKR 797 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 473,637 Number of Sequences: 2352 Number of extensions: 9770 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45668772 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -