BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1167 (508 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC075805-1|AAH75805.1| 960|Homo sapiens optic atrophy 1 (autoso... 32 1.0 BC058013-1|AAH58013.1| 276|Homo sapiens OPA1 protein protein. 32 1.0 AB011139-1|BAA25493.1| 978|Homo sapiens KIAA0567 protein protein. 32 1.0 >BC075805-1|AAH75805.1| 960|Homo sapiens optic atrophy 1 (autosomal dominant) protein. Length = 960 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = -2 Query: 318 HQETSNEINKAMTNTEEN*ILVSIEYVTTTKQNLSNR 208 H ET NE+ K + EE+ ++ + +TT ++NL +R Sbjct: 788 HNETKNELEKMLKCNEEHPAYLASDEITTVRKNLESR 824 >BC058013-1|AAH58013.1| 276|Homo sapiens OPA1 protein protein. Length = 276 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = -2 Query: 318 HQETSNEINKAMTNTEEN*ILVSIEYVTTTKQNLSNR 208 H ET NE+ K + EE+ ++ + +TT ++NL +R Sbjct: 104 HNETKNELEKMLKCNEEHPAYLASDEITTVRKNLESR 140 >AB011139-1|BAA25493.1| 978|Homo sapiens KIAA0567 protein protein. Length = 978 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = -2 Query: 318 HQETSNEINKAMTNTEEN*ILVSIEYVTTTKQNLSNR 208 H ET NE+ K + EE+ ++ + +TT ++NL +R Sbjct: 806 HNETKNELEKMLKCNEEHPAYLASDEITTVRKNLESR 842 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 62,915,278 Number of Sequences: 237096 Number of extensions: 1154609 Number of successful extensions: 1583 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1583 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4706589866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -