BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1164 (790 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC130613-1|AAI30614.1| 422|Homo sapiens casein kinase 1, gamma ... 31 6.3 BC017236-1|AAH17236.2| 398|Homo sapiens CSNK1G1 protein protein. 31 6.3 AF223357-1|AAO12758.2| 438|Homo sapiens casein kinase I gamma 1... 31 6.3 AB042563-1|BAB17839.1| 422|Homo sapiens casein kinase 1 gamma 1... 31 6.3 AB042562-1|BAB17838.1| 393|Homo sapiens casein kinase 1 gamma 1... 31 6.3 >BC130613-1|AAI30614.1| 422|Homo sapiens casein kinase 1, gamma 1 protein. Length = 422 Score = 30.7 bits (66), Expect = 6.3 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +1 Query: 607 DYKPASFLIGMQPNESINYCDFNYGLPHTLEWDILQTYPSPETGNKSPYR 756 D KP +FLIG Q N+ + H +++ + + Y PET PYR Sbjct: 164 DVKPENFLIGRQGNKKEHVI-------HIIDFGLAKEYIDPETKKHIPYR 206 >BC017236-1|AAH17236.2| 398|Homo sapiens CSNK1G1 protein protein. Length = 398 Score = 30.7 bits (66), Expect = 6.3 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +1 Query: 607 DYKPASFLIGMQPNESINYCDFNYGLPHTLEWDILQTYPSPETGNKSPYR 756 D KP +FLIG Q N+ + H +++ + + Y PET PYR Sbjct: 140 DVKPENFLIGRQGNKKEHVI-------HIIDFGLAKEYIDPETKKHIPYR 182 >AF223357-1|AAO12758.2| 438|Homo sapiens casein kinase I gamma 1 isoform protein. Length = 438 Score = 30.7 bits (66), Expect = 6.3 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +1 Query: 607 DYKPASFLIGMQPNESINYCDFNYGLPHTLEWDILQTYPSPETGNKSPYR 756 D KP +FLIG Q N+ + H +++ + + Y PET PYR Sbjct: 164 DVKPENFLIGRQGNKKEHVI-------HIIDFGLAKEYIDPETKKHIPYR 206 >AB042563-1|BAB17839.1| 422|Homo sapiens casein kinase 1 gamma 1L protein. Length = 422 Score = 30.7 bits (66), Expect = 6.3 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +1 Query: 607 DYKPASFLIGMQPNESINYCDFNYGLPHTLEWDILQTYPSPETGNKSPYR 756 D KP +FLIG Q N+ + H +++ + + Y PET PYR Sbjct: 164 DVKPENFLIGRQGNKKEHVI-------HIIDFGLAKEYIDPETKKHIPYR 206 >AB042562-1|BAB17838.1| 393|Homo sapiens casein kinase 1 gamma 1 protein. Length = 393 Score = 30.7 bits (66), Expect = 6.3 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +1 Query: 607 DYKPASFLIGMQPNESINYCDFNYGLPHTLEWDILQTYPSPETGNKSPYR 756 D KP +FLIG Q N+ + H +++ + + Y PET PYR Sbjct: 164 DVKPENFLIGRQGNKKEHVI-------HIIDFGLAKEYIDPETKKHIPYR 206 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,745,979 Number of Sequences: 237096 Number of extensions: 2343351 Number of successful extensions: 3268 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3206 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3268 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9646050614 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -