BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1164 (790 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 26 0.35 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 22 5.7 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 22 7.5 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 9.9 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 9.9 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 21 9.9 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 26.2 bits (55), Expect = 0.35 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -3 Query: 656 MLSFGCIPIKNEAGL*SKSPIDV 588 ML GC+ +KNE + K+ +D+ Sbjct: 50 MLESGCVSLKNEVNIMMKNVVDI 72 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 22.2 bits (45), Expect = 5.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 520 ETQAKYRRMSSAQSV 476 ETQ+ YR M QSV Sbjct: 391 ETQSNYREMEKRQSV 405 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.8 bits (44), Expect = 7.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 382 LTNTQNADTELGGMKMCV 435 L NT A +E GG+ C+ Sbjct: 165 LRNTSIAKSEFGGITQCI 182 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.4 bits (43), Expect = 9.9 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -1 Query: 418 LLTRYQHFVCLLRKKSNRLPNFDGISYRLISQ 323 L T + + ++ + RLP+FD +RL+ Q Sbjct: 806 LWTSVKKALMIVGIRPERLPSFDDECWRLMEQ 837 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.4 bits (43), Expect = 9.9 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -1 Query: 418 LLTRYQHFVCLLRKKSNRLPNFDGISYRLISQ 323 L T + + ++ + RLP+FD +RL+ Q Sbjct: 844 LWTSVKKALMIVGIRPERLPSFDDECWRLMEQ 875 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.4 bits (43), Expect = 9.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 569 KNPNSCRRQSVILTISQPH 625 ++P+S R S L SQPH Sbjct: 36 RSPSSSRSPSPSLLTSQPH 54 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 226,945 Number of Sequences: 438 Number of extensions: 5329 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24882285 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -