BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1163 (708 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 24 5.4 U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 23 7.1 AM182453-1|CAJ65691.1| 168|Anopheles gambiae globin 1 protein. 23 7.1 AM182452-1|CAJ65690.1| 168|Anopheles gambiae globin 1 protein. 23 7.1 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 23 7.1 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 23 7.1 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 23 7.1 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +1 Query: 442 EIKPKSNISRLLHKCLLQPSTVLDEKP 522 ++K N SR+ C++ P+ DE+P Sbjct: 788 KVKTTINTSRIPSMCIITPTNSDDEQP 814 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 23.4 bits (48), Expect = 7.1 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 75 EDLGIHCYLYYIVM 116 ED+G++ Y YY +M Sbjct: 227 EDIGLNAYYYYFMM 240 >AM182453-1|CAJ65691.1| 168|Anopheles gambiae globin 1 protein. Length = 168 Score = 23.4 bits (48), Expect = 7.1 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -3 Query: 235 GFTGSEAKNLFSTLRVLHSDLVSFLTNIFVCMNFTELHFYI 113 G T S+ L + ++ DLV+ NIFV M F E Y+ Sbjct: 25 GLTKSQKVALIAAWSIVKKDLVTHGRNIFV-MFFEEYPQYL 64 >AM182452-1|CAJ65690.1| 168|Anopheles gambiae globin 1 protein. Length = 168 Score = 23.4 bits (48), Expect = 7.1 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -3 Query: 235 GFTGSEAKNLFSTLRVLHSDLVSFLTNIFVCMNFTELHFYI 113 G T S+ L + ++ DLV+ NIFV M F E Y+ Sbjct: 25 GLTKSQKVALIAAWSIVKKDLVTHGRNIFV-MFFEEYPQYL 64 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.4 bits (48), Expect = 7.1 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 75 EDLGIHCYLYYIVM 116 ED+G++ Y YY +M Sbjct: 227 EDIGLNAYYYYFMM 240 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.4 bits (48), Expect = 7.1 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 75 EDLGIHCYLYYIVM 116 ED+G++ Y YY +M Sbjct: 227 EDIGLNAYYYYFMM 240 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.4 bits (48), Expect = 7.1 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 75 EDLGIHCYLYYIVM 116 ED+G++ Y YY +M Sbjct: 227 EDIGLNAYYYYFMM 240 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 736,634 Number of Sequences: 2352 Number of extensions: 14752 Number of successful extensions: 33 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72340815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -