BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1162 (783 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0963 + 8085918-8086225,8086335-8086461,8087134-8087688 28 9.6 05_02_0100 + 6594787-6594878,6595443-6595728,6595809-6595887,659... 28 9.6 >07_01_0963 + 8085918-8086225,8086335-8086461,8087134-8087688 Length = 329 Score = 27.9 bits (59), Expect = 9.6 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 Query: 364 PVKQTTNIKNRWRA*NRSLCSRMRL 290 P + +KNRW A RSL S+ RL Sbjct: 176 PGRSENTVKNRWNATKRSLNSKRRL 200 >05_02_0100 + 6594787-6594878,6595443-6595728,6595809-6595887, 6595964-6596013,6597281-6597478,6597555-6597612, 6598388-6598496,6599253-6599321,6599684-6599812, 6599970-6600082,6600386-6600479,6602827-6602917, 6604145-6604233,6604715-6604856,6605849-6606196, 6606314-6607408 Length = 1013 Score = 27.9 bits (59), Expect = 9.6 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 4/45 (8%) Frame = -3 Query: 163 NTRLCVAIQE*DGGTELLGPS----TQGSSHLT*MLINIYSLSRL 41 N LCV + + DGG EL QGSSH T L + S S + Sbjct: 40 NGLLCVGLHQTDGGDELYATECLKMNQGSSHETNKLDAVMSASTM 84 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,649,709 Number of Sequences: 37544 Number of extensions: 345536 Number of successful extensions: 577 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 571 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 577 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2103658836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -