BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1161X (562 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0810 + 20734490-20734606,20735182-20735433,20735521-207356... 31 0.63 >10_08_0810 + 20734490-20734606,20735182-20735433,20735521-20735664, 20735774-20736493,20736955-20737177,20737463-20737523, 20738294-20738615 Length = 612 Score = 31.1 bits (67), Expect = 0.63 Identities = 13/59 (22%), Positives = 25/59 (42%) Frame = -3 Query: 491 IYIIIS*NWKSYAQYENDCKINKNRNAKKTVDKEAQIFCHNTNMAVKYDNNNLQMLDKD 315 +Y I W + Y +DC + + V F H + + + Y+N N+ + K+ Sbjct: 224 VYDIRKYKWDGSSDYPSDCYCPPHLIGNRFVGITGLAFSHQSELLISYNNENIYLFPKN 282 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,171,304 Number of Sequences: 37544 Number of extensions: 210372 Number of successful extensions: 330 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 326 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 330 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1281410928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -