BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1161X (562 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 28 0.056 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 24 0.91 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 23 2.1 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 23 2.8 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 23 2.8 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 23 2.8 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 23 2.8 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 23 2.8 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 22 4.9 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 22 4.9 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 21 6.4 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 21 6.4 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 21 8.5 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 21 8.5 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 21 8.5 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 28.3 bits (60), Expect = 0.056 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -3 Query: 422 NRNAKKTVDKEAQIFCHNTNMAVKYDN-NNLQMLDK 318 N++ +K + +E FC N +KYD+ ++ LDK Sbjct: 323 NQDVQKKLREEINTFCPKNNKELKYDDIKEMEYLDK 358 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 24.2 bits (50), Expect = 0.91 Identities = 14/52 (26%), Positives = 21/52 (40%), Gaps = 7/52 (13%) Frame = -3 Query: 470 NWKSYAQYENDCKINKNRNAKKTVDKEAQIFC-------HNTNMAVKYDNNN 336 N + Y +Y K A++ +E +I HN N Y+NNN Sbjct: 51 NEREYRKYRETSKERSRDRAERERSREPKIISSLSNNTIHNNNYKYNYNNNN 102 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 23.0 bits (47), Expect = 2.1 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 383 IFCHNTNMAVKYDNNNLQMLDKDSCQVFLPS 291 I C N+ +Y NN++++ KD + PS Sbjct: 330 IGCWNSEHFFEYGGNNIEIIVKDPETLQFPS 360 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 2.8 Identities = 13/52 (25%), Positives = 20/52 (38%), Gaps = 7/52 (13%) Frame = -3 Query: 470 NWKSYAQYENDCKINKNRNAKKTVDKEAQIFC-------HNTNMAVKYDNNN 336 N + Y +Y K ++ +E +I HN N Y+NNN Sbjct: 51 NEREYRKYRETSKERSRDRTERERSREPKIISSLSNNTIHNNNYKYNYNNNN 102 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 2.8 Identities = 13/52 (25%), Positives = 20/52 (38%), Gaps = 7/52 (13%) Frame = -3 Query: 470 NWKSYAQYENDCKINKNRNAKKTVDKEAQIFC-------HNTNMAVKYDNNN 336 N + Y +Y K ++ +E +I HN N Y+NNN Sbjct: 52 NEREYRKYRETSKERSRDRTERERSREPKIISSLSNNTIHNNNYKYNYNNNN 103 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 2.8 Identities = 13/52 (25%), Positives = 20/52 (38%), Gaps = 7/52 (13%) Frame = -3 Query: 470 NWKSYAQYENDCKINKNRNAKKTVDKEAQIFC-------HNTNMAVKYDNNN 336 N + Y +Y K ++ +E +I HN N Y+NNN Sbjct: 52 NEREYRKYRETSKERSRDRTERERSREPKIISSLSNNTIHNNNYKYNYNNNN 103 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 2.8 Identities = 13/52 (25%), Positives = 20/52 (38%), Gaps = 7/52 (13%) Frame = -3 Query: 470 NWKSYAQYENDCKINKNRNAKKTVDKEAQIFC-------HNTNMAVKYDNNN 336 N + Y +Y K ++ +E +I HN N Y+NNN Sbjct: 52 NEREYRKYRETSKERSRDRTERERSREPKIISSLSNNTIHNNNYKYNYNNNN 103 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 2.8 Identities = 13/52 (25%), Positives = 20/52 (38%), Gaps = 7/52 (13%) Frame = -3 Query: 470 NWKSYAQYENDCKINKNRNAKKTVDKEAQIFC-------HNTNMAVKYDNNN 336 N + Y +Y K ++ +E +I HN N Y+NNN Sbjct: 52 NEREYRKYRETSKERSRDRTERERSREPKIISSLSNNTIHNNNYKYNYNNNN 103 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.8 bits (44), Expect = 4.9 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 268 VIFVTSLV*LVINCVVKA 215 VIFVT LV V CVV A Sbjct: 62 VIFVTGLVGNVSTCVVIA 79 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 4.9 Identities = 10/44 (22%), Positives = 18/44 (40%) Frame = -3 Query: 470 NWKSYAQYENDCKINKNRNAKKTVDKEAQIFCHNTNMAVKYDNN 339 N K Y +Y K ++ +E +I +N + +NN Sbjct: 52 NEKEYRKYRETSKERSRDRTERERSREPKIISSLSNKTIHNNNN 95 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.4 bits (43), Expect = 6.4 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 268 VIFVTSLV*LVINCVV 221 VIFVT V +I C+V Sbjct: 42 VIFVTGFVGNIITCIV 57 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 21.4 bits (43), Expect = 6.4 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 470 NWKSYAQYENDCKIN 426 +WK A Y++ C+IN Sbjct: 147 SWKPPAIYKSSCEIN 161 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.0 bits (42), Expect = 8.5 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +3 Query: 357 RHICIMTKYLCFFIYCFFRVSVFI 428 RH + ++L FFI F + + I Sbjct: 402 RHFAAIIEWLSFFIVIFTYIIILI 425 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.0 bits (42), Expect = 8.5 Identities = 7/31 (22%), Positives = 19/31 (61%) Frame = +3 Query: 111 NCYFVEVLKSIYI*YSLTYQYVLLYLSQIFV 203 NC ++L ++ LT++ +L +++ ++V Sbjct: 245 NCKLNDILLTVRPHLELTFENILSHINTVYV 275 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.0 bits (42), Expect = 8.5 Identities = 7/31 (22%), Positives = 19/31 (61%) Frame = +3 Query: 111 NCYFVEVLKSIYI*YSLTYQYVLLYLSQIFV 203 NC ++L ++ LT++ +L +++ ++V Sbjct: 245 NCKLNDILLTVRPHLELTFENILSHINTVYV 275 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,978 Number of Sequences: 438 Number of extensions: 3542 Number of successful extensions: 18 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16195212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -