BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1160 (701 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 30 0.061 AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein p... 25 2.3 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 30.3 bits (65), Expect = 0.061 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = -2 Query: 352 HTIFHYGHCVKLYMRLQHYHRHRSTPCRTVKTLKTQRYIYVLYVQVL 212 HTIFH +L +RLQH TP ++ + RY + + Q + Sbjct: 925 HTIFHCVRHRELIIRLQHQVDEELTPENIIEVMSANRYNWSMVHQAV 971 >AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein protein. Length = 344 Score = 25.0 bits (52), Expect = 2.3 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -1 Query: 311 EATTLSPAQIDTVSNSENIENTKIYLCTLRSSIR 210 +A T S +D + S+N+ T Y+C R +IR Sbjct: 310 QACTNSVKCLDCGTRSQNLHATGSYMCPRRRTIR 343 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 735,359 Number of Sequences: 2352 Number of extensions: 15863 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71504505 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -