BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1160 (701 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. 24 1.6 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 24 1.6 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 23 2.1 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 3.7 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 21 8.6 >EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. Length = 200 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 527 VSNLSRAAQFLLRSVVKCGRS 465 + NL A +F++ + V+CGRS Sbjct: 93 LGNLDPANEFIVSTRVRCGRS 113 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 527 VSNLSRAAQFLLRSVVKCGRS 465 + NL A +F++ + V+CGRS Sbjct: 109 LGNLDPANEFIVSTRVRCGRS 129 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +2 Query: 356 VNESNPTWTGR 388 VNESN TW GR Sbjct: 390 VNESNITWPGR 400 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/25 (32%), Positives = 10/25 (40%) Frame = -3 Query: 450 HPHMSEDPHTPRASH*RRGLLRPVH 376 HPH PH +H + P H Sbjct: 327 HPHRGSSPHHQHGNHTMGPTMGPPH 351 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/35 (25%), Positives = 18/35 (51%) Frame = -2 Query: 349 TIFHYGHCVKLYMRLQHYHRHRSTPCRTVKTLKTQ 245 TIF + +C+ + + + +Y + S K L+ Q Sbjct: 214 TIFTFSYCIPMILIIYYYSQIVSHVVNHEKALREQ 248 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,258 Number of Sequences: 438 Number of extensions: 4300 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -