BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1158 (658 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A7M4G5 Cluster: Putative uncharacterized protein; n=1; ... 36 1.1 UniRef50_Q6GKW8 Cluster: At1g02290; n=2; Arabidopsis thaliana|Re... 34 2.6 UniRef50_A4U5S3 Cluster: Putative uncharacterized protein; n=3; ... 33 8.0 >UniRef50_A7M4G5 Cluster: Putative uncharacterized protein; n=1; Bacteroides ovatus ATCC 8483|Rep: Putative uncharacterized protein - Bacteroides ovatus ATCC 8483 Length = 757 Score = 35.5 bits (78), Expect = 1.1 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 1/80 (1%) Frame = -2 Query: 627 EAFRFEGRGSRCNY-TETLELISQDGWRHLRCSYLWALVTTNTI*WARNKSTHLSNKKKL 451 +A +FEG R +Y T TLE ++DGW L S +V ++ +S L + + Sbjct: 461 KAAQFEGSEIRTSYSTSTLEQNTEDGWVELSNSSKQGIVNIHSANIPETQSASLPD-NGI 519 Query: 450 RLLVAQAVENRYFIGYGQLT 391 R++ Q N +F+ G++T Sbjct: 520 RVITTQTSWNFWFVKDGKIT 539 >UniRef50_Q6GKW8 Cluster: At1g02290; n=2; Arabidopsis thaliana|Rep: At1g02290 - Arabidopsis thaliana (Mouse-ear cress) Length = 443 Score = 34.3 bits (75), Expect = 2.6 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +1 Query: 277 CLIRQELFSEMGSREKSFQGTEPLPHDPTNDLEMVERKGKLTIT-YKIPI 423 C I + + + ++S QGTEP+ HDPT+ + R +IT IP+ Sbjct: 314 CSIPDPFLTYLETTQRSIQGTEPVFHDPTHTVPSALRVSNYSITEQNIPL 363 >UniRef50_A4U5S3 Cluster: Putative uncharacterized protein; n=3; Magnetospirillum gryphiswaldense|Rep: Putative uncharacterized protein - Magnetospirillum gryphiswaldense Length = 399 Score = 32.7 bits (71), Expect = 8.0 Identities = 19/49 (38%), Positives = 23/49 (46%) Frame = +2 Query: 248 LCARNQNGKSVL*GKSSFRRWDHVRRAFRARSRCPMTLPTTWKWSSEKV 394 +C R Q G S RR RRA AR+R P L T W W+ +V Sbjct: 64 VCTRRQRGPS--------RRMVQQRRAAHARARWPWKLQTQWPWTDAEV 104 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 620,359,750 Number of Sequences: 1657284 Number of extensions: 11672195 Number of successful extensions: 24666 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 24052 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24664 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 49586781480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -